ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0311w (cGloII)

cytosolic glyoxalase II, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not food vacuole during ring and schizont and trophozoite

Who localised this protein by microscopy?

Urscher, M., Przyborski, J. M., Imoto, M., Deponte, M.
Distinct subcellular localization in the cytosol and apicoplast, unexpected dimerization and inhibition of Plasmodium falciparum glyoxalases. (2010 Apr, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol and not food vacuole during ring and schizont and trophozoite
  • "GFP fluorescence was evident only within the body of the parasite (excluding the food vacuole)."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: 3D7
  • Gene model mapping comments: blast from AY494055, annotation matches
  • Localisation record: cytosol and not food vacuole during blood stages
  • Other genes localised in this publication: glyoxalase I, targeted glyoxalase II, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10789

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFD0311w cytosolic glyoxalase II
MKPCAQVLVVPVLNDNFSYVIIDEKTKKAASIDPVEPDKVLKRIETANVELEYVLCTHHHYDHSGGNIRMRELKQNIKVV
GSAYEPTPGVNEKVYDGQIIRLGELNIKAIHAPCHTKGHILYYVYKTDEAKQEDHKYKPILFTGDTLFIAGCGRFFEGSA
KDMFKNIEKVKNMRKETLIYCGHEYTLNNLRFALSIENDNEYMKNKLNEVTEKLKNKEHSVPSTIEEENLINPFFRTHCY
VNKFNMNDEIKILDKLRQLKNNF

Gene-Specific Links for PFD0311w

General Sub-Cellular Localisation Links