ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0310w (Pfs16)

sexual stage-specific protein precursor, a gene from Plasmodium falciparum

Compiled localisation
cytostome and food vacuole and parasitophorous vacuole membrane during gametocyte stage ii and gametocyte
cleft like parasitophorous vacuole membrane protrusion and not osmiophilic body and not parasite plasma membrane during gametocyte stage ii
cytoplasmic structure and parasitophorous vacuole during gametocyte
during gametocyte stage i and gametocyte

Who localised this protein by microscopy?

Abdi, A., Eschenlauer, S., Reininger, L., Doerig, C.
SAM domain-dependent activity of PfTKL3, an essential tyrosine kinase-like kinase of the human malaria parasite Plasmodium falciparum. (2010 Oct, Cell Mol Life Sci) PubMed / full text
   more detail about this publication

parasitophorous vacuole during gametocyte
  • "IFA using an antibody against Pfs16 (PFD0310w), a protein that resides within the parasitophorous vacuole membrane, revealed that the GFP signal is confined within the gametocyte (Fig. 6a)."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: taken directly from publication
  • Localisation record: PV during gametocyte
  • Other genes localised in this publication: serine/threonine protein kinase, alpha tubulin 1

Camarda, G., Bertuccini, L., Singh, S. K., Salzano, A. M., Lanfrancotti, A., Olivieri, A., Scaloni, A., Sharma, A., Alano, P.
Regulated oligomerisation and molecular interactions of the early gametocyte protein Pfg27 in Plasmodium falciparum sexual differentiation. (2010 May, Int J Parasitol) PubMed / full text
   more detail about this publication

during gametocyte stage i
  • "Identity of early gametocytes, morphologically similar to asexual trophozoites, was confirmed by the positive reaction with antibodies against the early gametocyte protein Pfs16 (Bruce et al., 1994) (Fig. 1Aa)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7A
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during gametocyte stage I
  • Other genes localised in this publication: gamete antigen 27/25

Lanfrancotti, A., Bertuccini, L., Silvestrini, F., Alano, P.
Plasmodium falciparum: mRNA co-expression and protein co-localisation of two gene products upregulated in early gametocytes. (2007 Aug, Exp Parasitol) PubMed / full text
   more detail about this publication

cleft like parasitophorous vacuole membrane protrusion and cytostome and food vacuole and parasitophorous vacuole membrane and not osmiophilic body and not parasite plasma membrane during gametocyte stage ii
  • "This analysis clearly showed co-localisation of Pfpeg3/mdv1 and Pfs16 in the membrane of the parasitophorous vacuole surrounding the gametocyte (Fig. 3A). These proteins were also found in the multi-laminate membranes of the circular clefts which protrude from the PVM and seal portions of the erythrocyte cytoplasm ([Sinden, 1982 and [Bannister et al., 2005) (Fig. 3B). Co-localisation of Pfpeg3 and Pfs16 was also readily detectable in the membrane of vacuolar structures within the gametocyte cytoplasm (Fig. 3C). We propose that these are parasite food vacuoles. "
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from M64107, inconsistent 5' UTR
  • Localisation record: PVM and FV and cleft like PVM protrusions and cytostome and not osmiophilic bodies and not PM during stage II gametocyte
  • Other genes localised in this publication: male development gene 1

Eksi, S., Haile, Y., Furuya, T., Ma, L., Su, X., Williamson, K. C.
Identification of a subtelomeric gene family expressed during the asexual-sexual stage transition in Plasmodium falciparum. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during gametocyte
  • "The parasites were then dual labeled with rabbit IgG antibodies generated against MSP1 (MR4/ATCC, Manassas, VA), a marker for all early stage parasites, or Pfs16, a marker for gametocytes, and mouse IgG antibodies generated against Pfg14.744 (744) or Pfg14.748 (748) followed by fluorescein isothiocyanate (FITC)-labeled anti-rabbit IgG and tetramethylrhodamine isothiocyanate (TRITC)-labeled anti-mouse IgG. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during gametocyte
  • Other genes localised in this publication: Plasmodium exported protein, unknown function, Plasmodium exported protein (PHISTa), unknown function, merozoite surface protein 1

Baker, D. A., Daramola, O., McCrossan, M. V., Harmer, J., Targett, G. A.
Subcellular localization of Pfs16, a Plasmodium falciparum gametocyte antigen. (1994 Feb, Parasitology) PubMed / full text
   more detail about this publication

cytoplasmic structure and cytostome and food vacuole and parasitophorous vacuole membrane during gametocyte
  • "It was detected in the outer membrane region of gametocytes and more specifically on the parasitophorous vacuole membrane (pvm), since, during gametogenesis when the pvm disintegrates, the majority of the antigen was detected on the remains of this membrane in multilaminated whorls and not on the gamete plasma membrane. The antigen was also present on other gametocyte cellular structures, including those which we believe to be Garnham bodies, present in the host cell cytoplasm of some gametocytes. The antigen was present too on the membrane surrounding cytosomes and the resulting food vacuoles in the parasite cytoplasm."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM and cytoplasmic structures and FV and cytostome during gametocyte
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84691

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_000930 sexual stage antigen s16, putative
  • PKH_030840 sexual stage-specific protein precursor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD0310w sexual stage-specific protein precursor
MNIRKFIPSLALMLIFFAFANLVLSDANDKAKKPAGKGSPSTLQTPGSSSGASLHAVGPNQGGLSQGLSGKDSADKMPLE
TQLAIEEIKSLSNMLDKKTTVNRNLIISTAVTNMIMLIILSGIVGFKVKKTKNADDDKGDKDKDKDNTDEGDEGDDS

Gene-Specific Links for PFD0310w

General Sub-Cellular Localisation Links