ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0305c (Vacuolar ATP H+ Synthase subunit b)

vacuolar ATP synthase subunit b, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte plasma membrane during ring
intracellular during trophozoite
parasite plasma membrane during intraerythrocytic and trophozoite
during merozoite and ring and schizont and trophozoite
cytoplasmic vesicle and food vacuole and not mitochondrion and not nuclear envelope and not nucleus and parasitophorous vacuole membrane during intraerythrocytic

Who localised this protein by microscopy?

Marchesini, N., Vieira, M., Luo, S., Moreno, S. N., Docampo, R.
A malaria parasite-encoded vacuolar H(+)-ATPase is targeted to the host erythrocyte. (2005 Nov 4, J Biol Chem) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during ring, intracellular and parasite plasma membrane during trophozoite
  • "Confocal fluorescent images in panels A, C, and E show intense labeling of the erythrocyte plasma membrane (A, ring stage), the parasite (C, trophozoite stage), or both parasites and erythrocyte cytosol (bright dots) and the plasma membrane of the erythrocytes (E, trophozoite stage) as detected using antibody against the B subunit of P. falciparum V-H+-ATPase (red) as described under "Experimental Procedures.""
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from AAA20218, annotation matches
  • Localisation record: erythrocyte membrane during ring, parasite and PPM during troph
  • Comment: strain information not found
  • Other genes localised in this publication: -

Hayashi, M., Yamada, H., Mitamura, T., Horii, T., Yamamoto, A., Moriyama, Y.
Vacuolar H(+)-ATPase localized in plasma membranes of malaria parasite cells, Plasmodium falciparum, is involved in regional acidification of parasitized erythrocytes. (2000 Nov 3, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and food vacuole and parasite plasma membrane and parasitophorous vacuole membrane and not mitochondrion and not nuclear envelope and not nucleus during intraerythrocytic
  • "As shown in Fig. 2, immunogold for V-ATPase subunit A selectively labeled food vacuoles (Fig. 2, A and C), small clear vesicles (Fig. 2, A and D), and the plasma membrane (Fig. 2, A and E). Immunogold particles were also occasionally observed in the parasitophorus vacuolar membrane (Fig. 2F), whereas essentially no labeling was seen in the nuclear envelope, nucleus (Fig. 2G), and mitochondrion (Fig. 2H). Control antibodies gave the essentially no labeling (Fig. 2B). A comparable immunogold labeling was also obtained with antibodies against V-ATPase subunit B (Fig. 2, I-L). "
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: FCR-3
  • Gene model mapping comments: Blast from U03915, annotation matches, length and chromosome correct with 7935619
  • Localisation record: Parasite Plasma Membrane and cytoplasmic vesicles and FV and weak PV membrane and not nuclear envelope and not nucleus and not mitochondrion during asexual
  • Other genes localised in this publication: vacuolar ATP synthase subunit a

Karcz, S. R., Herrmann, V. R., Trottein, F., Cowman, A. F.
Cloning and characterization of the vacuolar ATPase B subunit from Plasmodium falciparum. (1994 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during merozoite and ring and schizont and trophozoite
  • "The 56-kDa protein is expressed throughout the asexual life cycle and subcellular localization by indirect immunofluorescence shows that the protein has a heterogenous distribution over most of the parasite."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: heterogenous during asexual stages
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10536

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFD0305c vacuolar ATP synthase subunit b
MSKEVVNTKAEASRVNALAAVRNYKVCPRLEYKTISGVQGPLVIIEDVKFPKYSEIVTIHLSDNTTRQGQILEVCGKKAV
IQVFEGTSGIDNKNSYVEVSGDILKMPMSDEMLGRVFNGSGKPIDKGPNILADDYLDINGNPINPQCRVYPKEMIQTGIS
TIDVMNSIVRGQKIPLFSAAGLPHNEIGAQICRQASLVQGKDVLDHSDDNFAVVFGAMGVNMETARYFRQDFEENGKMER
VCLFLNLANDPTIERILTPRIALTTAEYLAFEKEMHVFVILTDMSSYADALREVSSAREEVPGRRGYPGYMYSDLSTIYE
RAGRVEGRNGSITQFPILTMPNDDITHPIPDLTGYITEGQIFVDRNLYNRQIYPPINVLPSLSRLMKSGIGHNMTRIDHP
YVSDQLYSNYAIAQDVKAMKAVIGEEALSNDDILYLEFLDKFEKRFITQNTYECRDIYQSLDIAWELLRIFPEDMLKKIK
TDILSKYYPRHHAN

Gene-Specific Links for PFD0305c

General Sub-Cellular Localisation Links