ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC1050w (TSN, Tudor-SN)

survival of motor neuron (SMN)-like protein, a gene from Plasmodium falciparum

Compiled localisation
nucleus during intraerythrocytic and ring and schizont and trophozoite

Who localised this protein by microscopy?

Hossain, M. J., Korde, R., Singh, P. K., Kanodia, S., Ranjan, R., Ram, G., Kalsey, G. S., Singh, R., Malhotra, P.
Plasmodium falciparum Tudor Staphylococcal Nuclease interacting proteins suggest its role in nuclear as well as splicing processes. (2010 Nov 15, Gene) PubMed / full text
   more detail about this publication

nucleus during intraerythrocytic

Dixit, A., Singh, P. K., Sharma, G. P., Malhotra, P., Sharma, P.
PfSRPK1, a novel splicing-related kinase from Plasmodium falciparum. (2010 Dec 3, J Biol Chem) PubMed / full text
   more detail about this publication

nucleus during ring and schizont and trophozoite
  • "PfSRPK1 co-localized with this nuclear protein in ring stages; both these proteins were in the nucleus. Although TSN continued to be present in the nucleus of trophozoites and schizonts, PfSRPK1 did not exhibit significant co-localization with it (supplemental Fig. S4)."
  • Microscopy type: Fixed Light
  • Microscopy method: antbody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nuclear during ring and trophozoite and schizont
  • Other genes localised in this publication: serine/threonine protein kinase, putative, Ser/Arg-rich splicing factor, putative

Hossain, M. J., Korde, R., Singh, S., Mohmmed, A., Dasaradhi, P. V., Chauhan, V. S., Malhotra, P.
Tudor domain proteins in protozoan parasites and characterization of Plasmodium falciparum tudor staphylococcal nuclease. (2008 Apr, Int J Parasitol) PubMed / full text
   more detail about this publication

nucleus during ring and schizont and trophozoite
  • "PfTSN shows a predominant nuclear localization"
  • Microscopy type: Fixed Light
  • Microscopy method: antibody to whole protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus during ring and trophozoite and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22025

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC1050w survival of motor neuron (SMN)-like protein
MDEFNETLEGLEEKIEEYEKQLALVRDEIKKYEKPEEENEQIKNLKKLEADMIEVINLTRDLIKYKKQNELENDENKELE
RSGEVAPDIHEHIKESNKFIGRTCSLNYENKMVYGLIENVVIHNNIEQLLIHIFETNDRIMIPPNYVQLNEVLNESALKE
NNQFQALYKKDGQWYDCIISKYKGDSFLITYIGYNNSEYVSTDQVRIKKKKKIKEIITPAGYKLPENLIIKEGDSLKVKM
AKKKKRIALKKKQKDEIMDKEFSNKSKQWRSFHEKAISKSKHLLVSTKRVENIENKNNQSNFNIRRKFDYNDNEE

Gene-Specific Links for PFC1050w

General Sub-Cellular Localisation Links