ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0920w (H2A.Z)

histone H2A variant, putative, a gene from Plasmodium falciparum

Compiled localisation
euchromatin and not heterochromatin during ring and schizont and trophozoite

Who localised this protein by microscopy?

Petter, M., Lee, C. C., Byrne, T. J., Boysen, K. E., Volz, J., Ralph, S. A., Cowman, A. F., Brown, G. V., Duffy, M. F.
Expression of P. falciparum var genes involves exchange of the histone variant H2A.Z at the promoter. (2011 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

euchromatin and not heterochromatin during ring and schizont and trophozoite
  • "Colocalization analysis shows PfH2A.Z overlap with the euchromatin marks H3K9ac and H3K4me3 but not with the subtelomeric heterochromatin marks H3K9me3 and HP1."
  • Microscopy type: Fixed Light, EM
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 21187892
  • Localisation record: euchromatin and not heterochromatin during ring and trophozoite and schizont
  • Other genes localised in this publication: histone H3, heterochromatin protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11251

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFC0920w histone H2A variant, putative
MEVPGKVIGGKVGGKVGGKVLGLGKGGKGKTGSGKTKKAPLSRASRAGLQFPVGRVHRMLKSRISSDGRVGSTAAVYAAA
ILEYLTAEVLELAGNATKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKALMNKVPLPPTAQKKPKKN

Gene-Specific Links for PFC0920w

General Sub-Cellular Localisation Links