ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0890w (Sec22)

SNARE protein, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during ring and schizont and trophozoite
cis-golgi and erythrocyte cytoplasm during trophozoite
cytoplasmic vesicle during ring and schizont and trophozoite

Who localised this protein by microscopy?

Ayong, L., Raghavan, A., Schneider, T. G., Taraschi, T. F., Fidock, D. A., Chakrabarti, D.
The longin domain regulates the steady-state dynamics of Sec22 in Plasmodium falciparum. (2009 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during trophozoite, cytoplasmic vesicle and endoplasmic reticulum during ring and schizont and trophozoite
  • "Immunogold labeling of ultrathin cryosections confirmed that GFP-PfSec22 localized predominantly to the parasite ER (Fig. 5A). Membrane vesicles were also labeled in the parasite cytoplasm (Fig. 5A, black arrowheads) and in the erythrocyte cytosol of some trophozoite-infected cells (Fig. 5B and C, white arrowheads)."
  • Microscopy type: Light
  • Microscopy method: GFP, antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: erythrocyte cytoplasm during trophozoite, ER and cytoplasmic vesicles during blood stages
  • Other genes localised in this publication: -

Ayong, L., Pagnotti, G., Tobon, A. B., Chakrabarti, D.
Identification of Plasmodium falciparum family of SNAREs. (2007 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi and endoplasmic reticulum during trophozoite
  • "Immunofluorescence analyses using the ER marker PfBip and cis-Golgi marker PfERD2 revealed that both GFP-PfSyn5p and GFP-PfSec22p are partly associated with the ER and with the cis-Golgi in transgenic cell lines (Fig. 6 and Fig. 7). "
  • Microscopy type: Light
  • Microscopy method: GFP
  • Strain: 3D7
  • Gene model mapping comments: Blast from DQ649420, annotation matches
  • Localisation record: ER and cis Golgi during trophozoite
  • Other genes localised in this publication: syntaxin, Qa-SNARE family, ER lumen protein retaining receptor, heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11843

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFC0890w SNARE protein
MCDVVLLCRVSDGMTLVETNSETKSISHKLELKKLCKKLYSFPNLSTVTSNNFNYHFLIENGIAYIAVFPVTYPKKLAFL
FLNDICKQFNEELMIQYGTHSIDYRSIIETIEKPYSFIKFDRKITKIKQEYKDPRSNIAIKKLNESLNEVSSIMKKNIDD
ILMRGENLEDVGRKAFNLKYESEKFKKVSRVLNLKYALYQYGILASIVIFFFLIIIFKNYF

Gene-Specific Links for PFC0890w

General Sub-Cellular Localisation Links