ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0635c (eIF4E)

translation initiation factor 4E, a gene from Plasmodium falciparum

Compiled localisation
cytosol during intraerythrocytic

Who localised this protein by microscopy?

Tuteja, R., Pradhan, A.
PfeIF4E and PfeIF4A colocalize and their double-stranded RNA inhibits Plasmodium falciparum proliferation. (2010 Nov, Commun Integr Biol) PubMed / full text
   more detail about this publication

cytosol during intraerythrocytic
  • "In the present study we report further characterization of PfeIF4E and PfeIF4A (PfH45) and show that these factors colocalize in the cytosol in the intraerythrocytic developmental stages of Plasmodium falciparum."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during intraerythrocytic
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14061

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC0635c translation initiation factor 4E
MKYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRPLAKFNSVQKFWQLWNRLPQP
SDLLAQRSMTRFSEDGIFRIVDALMIFRDNIQPMWEDPANSGGGHFEYKILPKDYPYSQIDEFWNNLVLAIIGCSLKHYD
LITGIRLVDKLSTTRYGYIRIEIWYTTITDESVKNYLRKDLEEHMCNRIDGSTIFPPRVKSLSHIHR

Gene-Specific Links for PFC0635c

General Sub-Cellular Localisation Links