ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0435w ()

parasite-infected erythrocyte surface protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol during 18-36 hours after merozoite invasion
cytoplasm and exported and not maurer's cleft and tubulovesicular membrane during trophozoite

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

erythrocyte cytosol during 18-36 hours after merozoite invasion, cytoplasm and exported and tubulovesicular membrane and not maurer's cleft during trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_35019

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC0435w parasite-infected erythrocyte surface protein
MKVGIIFFCLFFFVVLGACNNVKERIFKNIKKRTKFIILNEPIVDLSFSENLFHTLLFDLDVDKNLYTLDESLLNLENLN
YSSIFRLLVDTYKNIKENEDDNKNIRYIFLGTSFSRIHPLNFEYFLRKLNKYIYNGNIYEKGNVDIRGILEEYNKEIEEK
KLEKQKLNKIKDKNNNNNNNNNSKFSKDGDNEDFNNKNDLYNPSDKLYNNNDDIDVHELLEEIITKEKRFFLNDDDDNDS
NDKYILKTDEVNKYKGFFIGYGFNDDIPSVIHHYNFDKNFLFPSLNSGIILDITLLKNIYEVSNILLSNNEKDQSIHIDY
IYEVTKYIKENLRVRLTHSENVCLNEEQNIHLLDNDPNNFEIYKYYQVLNLFKDYNKNTEEKQYEKIGHENVRHEETSSE
GNENLNRNTKHNNDNNNDNNNYSEDAIAELLLSYFNVFYPISTCMCYSIRSKHESLMDYDKYHMINLENDIKLKHYIKET
EEIHFNSIEEYKMKLNRINYKYDTLLEEHENLVTHKNILIGIKTSINTEEERIPHIKNTYDNKENTQIIFNTFNYDNKLK
EKNTFGFYNNSLLQNALENDNIDLDIIYMSDKESQKYDNLYFNSKVTSKEGLCEKLKHMIYYYYEEYVMKNSEKKYFFIA
DDDTFVNVKNLIDVTNLTLNTCSHSKKYMYDKYIKSYDFVKENEALFLQNFPKKTLFLYSYLKDTFAKTIQTLKKYDYVP
KYCQGGILSKKHKNNDSDDDHDHHVGNKQNNDSTNHQDIEKNQVNVINNNNNNNNNKAKSIPIYLGRRYSYNTFSTNSNE
YFYDYLTGGAGILINDETAKRIYECKECTCPSTNSSMDDMIFGKWAKELGILAINFEGYFQNSPLDYNKKYINTLVPITY
HRLNKNRTTKESRDMYFNYLVNYNRNDKEQNKDIYVDYLDRNHKNMIDNVFHYFFYVNMYDEKNKVVTKIEHNADMNSKK
NKSKNPQKLNNTQGDKNVNDDENVNDDENVKGDENVKGDENVKGDEYMKGDENVKGDENVKDDENVKDDENIKGDDNNYN
VDNMENIDDIINMVESVDDDVMERNKKGTGKEKKDDKNHNNKEKATDVKKSSVPTNNIDKNEDTTKYVIKMNEKIYNRMQ
ESGKYKQLFDINKFFKKEIEGHPYFQKIKKKNEKAKKEKEKMNQLKKQKDYTNNYFHTSNMQGNFNQQKMGNYQNQENEE
NDFFDQRPEIEEDAINPMDYEEYMENLSNFEDDGEPYDEYDDYDDFVNTINADKLKINDQNKHLYEQIKDIAQPPVNFQN
DQNSNTFDFDTDEL

Gene-Specific Links for PFC0435w

General Sub-Cellular Localisation Links