ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0355c ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

merozoite surface during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84564

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_119535 hypothetical protein, conserved
  • PKH_083170 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC0355c conserved Plasmodium protein, unknown function
MKELVSSFLNNLSQVSSELSCCKNKKFHVDNVSLCGIEDVLHNRDRSSLIDKEKINTLMELYKNENIYESYEEYDIDKYE
KIKNNNILKNMGGNKLNVCNACLFCNNNNSQNHMNKNKNVSENINNVIDLDDEILIANFPFNSLRDVENLTYTNSEHTLN
NKEYSYIKNSIDLDFDQQIKNQKKNNNSKNSSHLYNEIVKEGEYDNDDSPNFDEDSSQFKFSVLNNIKNNIHNTKDELTN
NYNIIKNTLNQDYEKNIDQKEKHDIIVDNMVNSVDYQNDMDTNIKTKKKKKNQAYSNFYAKSDLPSSNIDEGSCKGCKAS
DTSSEFFSVASGMKPNN

Gene-Specific Links for PFC0355c

General Sub-Cellular Localisation Links