ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0180c (ALV1)

inner membrane complex protein 1a, putative, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during gametocyte

Who localised this protein by microscopy?

Gould, S. B., Tham, W. H., Cowman, A. F., McFadden, G. I., Waller, R. F.
Alveolins, a new family of cortical proteins that define the protist infrakingdom Alveolata. (2008 Jun, Mol Biol Evol) PubMed / full text
   more detail about this publication

inner membrane complex during gametocyte
  • "Alveolins localize to the cortical regions of alveolate cells. Immunofluorescence detection of alveolin proteins in the dinoflagellate Karlodinium veneficum (A–D), gametocytes of the apicomplexan parasite Plasmodium falciparum (E–H), and the ciliate Paramecium caudatum (I–L)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: alveoli during gametocyte
  • Other genes localised in this publication: membrane skeletal protein IMC1, SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37657

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC0180c inner membrane complex protein 1a, putative
MFNACQLKSNCCNEEAEEMRQSMNGKYEDLYGEHIINENSDLKKIIEGKPDLDKAVEIGQHTEREYVAITAYQPVDIVTR
TVEVPFVRTIETTVPKIVYEEKIKEVPRYIAKYVEKVVEVPEVKFVDKIVDVPDIQYCLKYVPKVEIQENIIKRPVFHKK
FVEKIVEVPKVKEMKRFHEVETVEYVIKYIPKDASKKTKKENETTACINETNDETNNEEEGRNVERGYIEHPNLNIRNGA
RLIMNGPPVVQQEGIIIEHPTTEMHTSITSSGTRENVSCFCNKNVQGNRQTNCYSLSGSCMCNPRTMGELKEKTNTMLHN
PRIEQVFKPKIVKNIEVQKHVPISVDVPVPYMVPKPVVVNVEVPVLKFRDTFVPVPVRRKIIPKIKWISDVYQVDCIKEK
PYLKIQDVIKPIPCDVDIKYRKYMEKACAVNPNELAQDDVHAMWMRVNAHLAEKKKKEYGEFYPYYKNEEENGNKMEENE
STNEEICKEEEIIYLEEDEEREFINKNENINNTEIKEDSNGKEINENINNKEINENINNKEINENSNGKEINNNSNGKEI
NNNSNGKEINNNSNGKEINNNSNGKEIHKNLSVTKENHNIYKNEINNDFAHINNDEKEKVIAEEHIFVRNKSNIETEKAY
DIFNVSKELRFKDDNKMLQTNYDINLNLNENEKTYLFENSDIFMNEMKEDIEKNKNNNTSNKYIEEQLTASLYPSHPLAM
TYLQNKWIQTDTLKTHELYNNDFIRASVNANYNLQSGNIVMSDIMRNNEFLKSANPIISPFSPGNIRNLENYYNNLIIQN
LDQQNKQSNYYEHMNNQINYDNYNNYENFENHQIKLYEQIIKEEQQNEKSNSKCCNYFCDK

Gene-Specific Links for PFC0180c

General Sub-Cellular Localisation Links