ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0160w (AnkDHHC)

palmitoyl transferase, a gene from Plasmodium falciparum

Compiled localisation
golgi apparatus during schizont

Who localised this protein by microscopy?

Seydel, K. B., Gaur, D., Aravind, L., Subramanian, G., Miller, L. H.
Plasmodium falciparum: characterization of a late asexual stage golgi protein containing both ankyrin and DHHC domains. (2005 Aug, Exp Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus during schizont
  • "Fig. 5. Confocal microscopy localizes PfAnkDHHC to Golgi."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from NP_473165, annotation doesn't match
  • Localisation record: golgi during schizont
  • Other genes localised in this publication: ER lumen protein retaining receptor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24410

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFC0160w palmitoyl transferase
MNDNESLDSEVLEKQYEIIKYAKYQDFIRLQILIQPYLLNNDIEMLNSINILHWACYCGFTELVKKLISFNCDIEKEDLV
NNDTPIYYAIKNSNYEIVLLLIKCFGISILFHKNRRRMSPFLTAICEFNEDKILEALHILELLYMNGVSLEEQNEHGQTA
LFLSVKKNNISTLQWLLTKEVNINHRDFYGNTVLHIAVRHCDIDILRLLCDYGCLNMVYYSSIENKNTNVFQLCIKNRYF
LVYILLKKWVLQNKICSKLKICKTIYAFYFWFFAILNLIVYFNIAHSFSIINKYHFKSLIWITIWFFQQFLWCMLYFKSP
GFYKENHMFNKNKKNIQSSKYKNSNPMYNGTFKTNAEYQLNNIEREIFQINKKLISTNFNTLTPINHDQALSNKYNDILI
NLEYQKLSLYSQVSQERINSLDEDYRNAILYNQNPRNICVTCNIIKPPRVHHCAECFHCIVHQDHHCVWVDNCIGIKNQR
CFYMFIFCIFVLLLYNYYYVYLYFHLFQATINYAFGSLVILCNFINVTLFAFITYLFARNTRTILTNVTFYEHYKKPNHI
TDKYNTDLRCWDFQNLNLKGILKNIYYFWSLNYDEPYIRQCTKTSNDVCYTLISNT

Gene-Specific Links for PFC0160w

General Sub-Cellular Localisation Links