ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFC0140c (NSF)

N-ethylmaleimide sensitive fusion protein, putative, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasmic structure during early trophozoite
erythrocyte cytoplasm during schizont and trophozoite
during not merozoite

Who localised this protein by microscopy?

Hayashi, M., Taniguchi, S., Ishizuka, Y., Kim, H. S., Wataya, Y., Yamamoto, A., Moriyama, Y.
A homologue of N-ethylmaleimide-sensitive factor in the malaria parasite Plasmodium falciparum is exported and localized in vesicular structures in the cytoplasm of infected erythrocytes in the brefeldin A-sensitive pathway. (2001 May 4, J Biol Chem) PubMed / full text
   more detail about this publication

erythrocyte cytoplasmic structure during early trophozoite, erythrocyte cytoplasm during schizont and trophozoite, during not merozoite
  • "At the early trophozoite stage, PfNSF appeared in the extraparasite space and seemed to be associated with several apparent vesicular structures outside the parasites in the erythrocyte cytoplasm. At the trophozoite stage, the PfNSF-positive vesicular structure seems to be more discrete and distributed throughout erythrocyte cytoplasm, which becomes weak at the schizont stage and disappears at the merozoite stage (Fig. 6). These results indicate that export of PfNSF occurs at the early trophozoite stage. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3
  • Gene model mapping comments: Blast from CAB10575.1, annotation matches
  • Localisation record: vesicles in RBC cytoplasm during early trophozoite, RBC cytoplasm during trophozoite, weak RBC cytoplasm during schizont, not during merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11240

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_040160 N-ethylmaleimide-sensitive fusion protein, putative
  • PY05628 ATPase, AAA family, putative
  • PVX_119275 N-ethylmaleimide sensitive fusion protein, putative
  • PCHAS_040250 N-ethylmaleimide-sensitive fusion protein, putative
  • PKH_083720 N-ethylmaleimide sensitive fusion protein, putative
  • TGME49_118510 N-ethylmaleimide-sensitive factor
  • NCLIV_011040 N-ethylmaleimide-sensitive factor, putative
  • cgd2_3010 N-ethylmaleimide-sensitive factor (NSF1)-like AAA ATpase involved in vesicular transport
  • Chro.20314 N-ethylmaleimide-sensitive factor; NSF; Sec18p
  • CMU_030460 vesicle-fusing ATPase, putative
  • TP02_0172 N-ethylmaleimide sensitive protein, putative
  • TA11700 N-ethylmaleimide-sensitive factor, putative
  • BBOV_II007200 N-ethylmaleimide-sensitive factor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFC0140c N-ethylmaleimide sensitive fusion protein, putative
MRTNLQCCKLQSQELALTNCGFINIGLYNNLKKSVKSNDVYSEVGNMVLILRGDGNIGREEIALNTCQREFSRIQLKELV
EINILDKENKNDLVNFIPIDSIELEVNLFVKPDRLIEMEDEKLEDVFKKYFLNHILTKGQILALKYNDILLKCIVKDLKT
ADFDEIKRLNNSNNNNNNRNSSGFSGYFNKWSPGFNNADNQNLSYNRYERGILFENTECIFTSISDGGKLCIESKKVLKQ
NIIKNNFNFEELGIGALDEEFKTIFRRTFASRIYPNYIIKQLSIKHVKGMILYGPPGTGKTLIARQIGKTLNAREPKIIN
GPEILNKYVGQSEENIRNLFKDAEMEYKQSGENSLLHIIILDEIDAICRQRGNVGSSSTGVNDSVVNQLLSKIDGVNSLN
NILLIGMTNRIDLIDEALLRPGRFELHIEISLPNKEGRIQILNIHTKNMRMSNKLSSDVNILELAERTPNFSGAEIEGLV
RNTVSYAFERHINFNDLTKPINADDIMITKNDFMKALKETKPAFGAEEDIIGNLLCNGIINYGKEYENIENTCKLLIKQI
VDNENTKLMSILLYGENGSGKTTISAYIAKCANFHFTKFITPENLIGYSEIGRINYINKIFEDAYKTPLSLVILDNIERL
IDYTRIGPRFSNSILQAIMVLIKKKPKKENQKILIICTTSEYQFMKDVGLTKNFFVNIHVPLLSTSSSIKNVLQHRNQTY
HDFPNNEIEKVISSNIIKNIAIKNLLMIIDMASEASDDKNITSDVFLKIFNDCGLLLDDDTDY

Gene-Specific Links for PFC0140c

General Sub-Cellular Localisation Links