ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0815w (CDPK1)

calcium dependent protein kinase 1, a gene from Plasmodium falciparum

Compiled localisation
intracellular vacuole and parasitophorous vacuole membrane and tubulovesicular membrane during schizont and trophozoite
cytoplasm and residual body membrane during merozoite and schizont
not food vacuole membrane during early schizont

Who localised this protein by microscopy?

Green, J. L., Rees-Channer, R. R., Howell, S. A., Martin, S. R., Knuepfer, E., Taylor, H. M., Grainger, M., Holder, A. A.
The motor complex of Plasmodium falciparum: phosphorylation by a calcium-dependent protein kinase. (2008 Nov 7, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm and residual body membrane during merozoite and schizont, not food vacuole membrane during early schizont
  • "CDPK1 colocalizes with MTIP around developing merozoites in segmented schizonts but is also present in membranes around the mature food vacuole/residual body of the schizonts, whereas MTIP is absent (Fig. 2BFIGURE 2., panel i). … To exclude the possibility that CDPK1 is present within the food vacuole membrane, we stained parasites with antibodies against PfCRT, a known marker of the food vacuole membrane. There was no coincidence of staining in early schizonts and a small amount of colocalization in segmented schizonts (Fig. 2BFIGURE 2., panel iv and v)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Parasite periphery and residual body membrane during schizont and merozoite, not FVM during early schizont
  • Other genes localised in this publication: myosin A tail domain interacting protein, merozoite surface protein 1, chloroquine resistance transporter

Moskes, C., Burghaus, P. A., Wernli, B., Sauder, U., Durrenberger, M., Kappes, B.
Export of Plasmodium falciparum calcium-dependent protein kinase 1 to the parasitophorous vacuole is dependent on three N-terminal membrane anchor motifs. (2004 Nov, Mol Microbiol) PubMed / full text
   more detail about this publication

intracellular vacuole and parasitophorous vacuole membrane and tubulovesicular membrane during schizont and trophozoite
  • "In trophozoites and schizonts, intraerythrocytic stages of the parasite, gold labelling of PfCDPK1 was most prominent in the compartment of the parasitophorous vacuole and in all membranous systems derived from the parasitophorous vacuole (Fig. 6A–D)."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag after 48 amino acids
  • Strain: K1
  • Gene model mapping comments: Blast from X67288, annotation matches
  • Localisation record: PVM and tubulovesicular system and intraparasitic vacuoles during troph and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10071

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0211 calcium dependent protein kinase 5
  • PFC0420w (CDPK3) calcium dependent protein kinase 3
  • PFF0520w (CDPK2) calcium-dependent protein kinase
  • PBANKA_031420 calcium dependent protein kinase 1
  • PBANKA_040820 calcium dependent protein kinase 3
  • PBANKA_061520 (CDPK4) calcium dependent protein kinase 4
  • PBANKA_135150 calcium dependent protein kinase 5
  • PY02109 Plasmodium falciparum CDPK2 protein
  • PY03298 calmodulin-domain protein kinase
  • PY06394 calcium-dependent protein kinase-3
  • PY06527 calcium-dept. protein kinase
  • PVX_000555 calcium-dependent protein kinase 4, putative
  • PVX_002665 calcium-dependent protein kinase 1, putative
  • PVX_082820 calcium-dependent protein kinase, putative
  • PVX_119610 calcium-dependent protein kinase 3, putative
  • PCHAS_031630 calcium dependent protein kinase 1, putative
  • PCHAS_040910 calcium dependent protein kinase 3, putative
  • PCHAS_061690 calcium dependent protein kinase 4, putative
  • PCHAS_135610 calcium dependent protein kinase 5, putative
  • PKH_030080 calmodulin-domain protein kinase, putative
  • PKH_040260 protein kinase, putative
  • PKH_083010 calcium-dependent protein kinase 3, putative
  • PKH_121600 calcium-dependent protein kinase, putative
  • TGME49_006590 CAM kinase, CDPK family
  • TGME49_024950 CAM kinase, CDPK family TgTOXPK2
  • TGME49_042400 CAM kinase, CDPK family
  • NCLIV_011980 Calmodulin-like domain protein kinase isoenzyme gamma, related
  • NCLIV_017560 Calcium-dependent protein kinase 2, related
  • NCLIV_044270 hypothetical protein
  • NCLIV_047750 hypothetical protein
  • NCLIV_070280 hypothetical protein
  • cgd2_1060 calcium/calmodulin dependent protein kinase with a kinas domain and 4 calmodulin-like EF hands
  • cgd2_1300 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • cgd3_920 calmodulin-domain protein kinase 1, putative
  • cgd5_820 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • Chro.20118 CDPK2
  • Chro.20142 calcium-dependent protein kinase
  • Chro.30121 hypothetical protein
  • Chro.50305 calmodulin-domain protein kinase 1
  • CMU_009030 protein kinase domain-containing protein
  • CMU_009310 calcium-dependent protein kinase, putative
  • CMU_041080 calcium-dependent protein kinase, putative
  • CMU_042610 calcium-dependent protein kinase, putative
  • TP01_1073 calmodulin-domain protein kinase, putative
  • TP02_0399 calcium-dependent protein kinase, putative
  • TA12965 calcium-dependent protein kinase, putative
  • TA16180 calmodulin-like domain protein kinase, putative
  • TA16570 calmodulin-domain protein kinase, putative
  • BBOV_III005470 protein kinase domain containing protein
  • BBOV_IV003210 calcium-dependent protein kinase 4
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0815w calcium dependent protein kinase 1
MGCSQSSNVKDFKTRRSKFTNGNNYGKSGNNKNSEDLAINPGMYVRKKEGKIGESYFKVRKLGSGAYGEVLLCREKHGHG
EKAIKVIKKSQFDKMKYSITNKIECDDKIHEEIYNEISLLKSLDHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINR
HKFDECDAANIMKQILSGICYLHKHNIVHRDIKPENILLENKHSLLNIKIVDFGLSSFFSKDNKLRDRLGTAYYIAPEVL
RKKYNEKCDVWSCGVILYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISEEAKELIKLMLTYDYNKRITAKEAL
NSKWIKKYANNINKSDQKTLCGALSNMRKFEGSQKLAQAAILFIGSKLTTLEERKELTDIFKKLDKNGDGQLDKKELIEG
YNILRSFKNELGELKNVEEEVDNILKEVDFDKNGYIEYSEFISVCMDKQILFSEERLRDAFNLFDTDKSGKITKEELANL
FGLTSISEQMWNEVLGEADKNKDNMIDFDEFVNMMHKICDNKSS

Gene-Specific Links for PFB0815w

General Sub-Cellular Localisation Links