ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0640c (Sec31, Sec31p)

sec31p, a gene from Plasmodium falciparum

Compiled localisation
cytoplasmic vesicle and erythrocyte cytoplasmic vesicle during ring and schizont

Who localised this protein by microscopy?

Adisa, A., Albano, F. R., Reeder, J., Foley, M., Tilley, L.
Evidence for a role for a Plasmodium falciparum homologue of Sec31p in the export of proteins to the surface of malaria parasite-infected erythrocytes. (2001 Sep, J Cell Sci) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and erythrocyte cytoplasmic vesicle during ring and schizont
  • "In ring-stage parasites, a slice through the centre of a parasitised erythrocyte revealed labelling of a compartment(s) within the parasite cytoplasm. In addition, punctate structures were observed within the erythrocyte cytosol (Fig. 4a). A confocal slice taken near the surface of the infected erythrocyte provided evidence that the punctate structures are often closely connected to the erythrocyte membrane (Fig. 4b). In more mature stage-infected erythrocytes, the localisation of PfSec31p in compartments within the erythrocyte cytosol was more marked. An uneven or polarised labelling pattern was still observed within the parasite cytoplasm, but PfSec31p appeared to be largely associated with structures in the erythrocyte cytosol that appear vesicular in nature (Fig. 4c,d). This labelling pattern suggests that PfSec31p is exported into the host cell cytoplasm."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: K1
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Cytoplasmic vesicles and RBC cytoplasm vesicles during ring and schizont
  • Other genes localised in this publication: endoplasmic reticulum-resident calcium binding protein, small GTP-binding protein sar1, erythrocyte membrane protein 3, circumsporozoite-related antigen

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11128

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0640c sec31p
MALKSINISGNFEWCPFEEYKNYLLCFNSHNLLYSNNNSLNNYIYLLDINLNSEIRNLEIVNKYNFEDALKYDNDVIKGG
NKKNNKNNKNNHNNNSVNEYVTCFEWMNSNNFVDINNNEELSKGIIVGGLTNGDIVLLNAKNLFETNRNYDNFILSKTNI
HDNGINCLEYNRHKNNLIATGGNDGQLFITDIENLYSPTSYDPYLDKNNLQKITCLNWNKKVSHILATSSNNGNTVIWDL
KIKKSAVSFRDPHSRTKTSSLSWLSNQPTQVLISYDDDKNPCLQLWDLRNSNYPIKEIIGHSKGINNICFSPIDTNLLLS
SGKDVTKCWYLDNNNFDIFNEINNSANNIYSKWSPYIPDLFASSTNMDTIQINSINNGNKMTSKYIPTFYKKEAGICIGF
GGKICTFDNSTNNMSNVNNMNNVNNMNNINSFNNDNSCDGEYDSNKGKNKSTQKKFLIKYHIYPTDMELISEADNFEKYI
TSGNYKEFCESKINKCDDDHEKLTWQILQLLCTSQRGDIVKYLGHDINNIVDKIMQTIGKQPGFIFKTLIDEKENNNNNN
NNNSTNQMYQNDVLLHNDPNLMNNYLLKDNMNPNIMLNNNNNNINNRTGTNVMYSNGQNLLGDTNHNEENFNGNFDIDPE
KFFRELGEKTENEKIKQNEEDISGNDEHLLNSSIKGKENKTKNKKSGLGTDDNNDNGDHNKNEGSNINGEHVSEHILNEK
NNTNNWNLGIEAIIKECVLIGNIETAVELCLHKNRMADALLLSSFGGEQLWHKTKTIYIKKQNDNFLKNINYVLDDKLEN
LINNVDLNSWEEALSILCTYAINNPNFNSLCEMLAKRLQNEKFDIRAASICYLCACNFSETVEIWNNMPSKKTSLLNVLQ
DIVEKMTILKMIIKYENFNSIMNQKISQYAELLANSGRLKAAMTFLCLIQHDQSIESLILRDRIYNSANHVLCQQIKPPI
SPFQIVDIKPSPNVYQNNMYNNNNNNNNININSSSNNNNNNNNNKVLSSMHHPMQQFNQCNVNKMYTSTSNIINNNTMNS
NFKSVIPPPLPMNTQMNNSTSSIQPPPSVPPTKFHTQIINNTMNSRSSIATTTKNYPTSNLNSVIPTSMNNMNTNISHGN
NVTPPYMSQTNVAVPNMNNNNNNNNTMNPTYPSLPKFPNYNLNSQVQQNSIIPEKQLTSPMFSSNSYGNINKTHTTNNAV
PPPPNVTSSVVTPPMPSNQLNNTRSSFADIQNVVSPPRNKNQSISSTANLNYQHDNQFNKRECMEQPVYPMTNQSSMFSM
NNTMQKKNVPGGFQDNTSQMNYGMQPTGSPPPSSLSTTSPIAGALTVTPGMPVPWPIPTTTQQLGSTTQSTANENKKIQT
ATKEQNGVLMNRNHIENIKKTISNLLNIYTSQESVKKKADDVSSKVYELFEKLDCGAFNEQINDSLLNLVNCINANDFKT
TNKIIVDLSRNLWDGSNKAWIMGVKHIIPKC

Gene-Specific Links for PFB0640c

General Sub-Cellular Localisation Links