ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0570w (SPATR)

secreted protein altered thrombospondin repeat protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during sporozoite
rhoptry during ring and schizont and trophozoite
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Chattopadhyay, R., Rathore, D., Fujioka, H., Kumar, S., de la Vega, P., Haynes, D., Moch, K., Fryauff, D., Wang, R., Carucci, D. J., Hoffman, S. L.
PfSPATR, a Plasmodium falciparum protein containing an altered thrombospondin type I repeat domain is expressed at several stages of the parasite life cycle and is the target of inhibitory antibodies. (2003 Jul 11, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during sporozoite, rhoptry during ring and schizont and trophozoite
  • "Immunoelectron microscopy indicated that this protein was expressed on the surface of the sporozoites and around the rhoptries in the asexual erythrocytic stage."
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from sequence in 12716913, protein sequence matches, annotation matches
  • Localisation record: surface during sporozoite, rhoptries during blood stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_38860

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_030950 secreted protein with altered thrombospondin repeat domain, putative
  • PY02991 putative secreted protein with altered thrombospondin domain
  • PVX_002900 hypothetical protein, conserved
  • PCHAS_031160 secreted protein with altered thrombospondin repeat domain, putative
  • NCLIV_000860 SPATR, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0570w secreted protein altered thrombospondin repeat protein
MKKSRFLLLSIFFCFVTNISLEFKRKQKVEINSLQTNKNNDNIREEKIKGDVESQPDVDGDTCVIFSSSEGNSRNCWCPR
GYILCSEEDVLDVQGKLNEIKNKHERSLVTPLWMKRLCDNSNDVGFKSMSVVIDYELAVLCKDGSNKDYADFEIIGASGY
ITGEEMIEEQKRNPWYVPRKCTVNNFYLCRKVENDNVNCSYTPWSDWSACKNNTQKRYRKVRRSNQNNENFCLWNDKIVP
RNIMEQTRSC

Gene-Specific Links for PFB0570w

General Sub-Cellular Localisation Links