ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0540w (H4K20me3)

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
nucleus during ring and trophozoite

Who localised this protein by microscopy?

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

nucleus

Deitsch, K. W.
A mark of silence in malaria parasites. (2009 Feb 19, Cell Host Microbe) PubMed / full text
   more detail about this publication

nucleus during ring and trophozoite
  • "PfKMT1 and Genes Enriched in H3K9me3 Are Positioned at the Nuclear Periphery"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nuclear periphery during ring and trophozoite
  • Other genes localised in this publication: SET domain protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0540w conserved Plasmodium protein, unknown function
MNTHKNNDRFDEYSLNNNSNLNAYVNMSNEAHNNFLVNRRNDMNYEMYNSINSGHMSNINNNTNNLQDAYINKELHYMNS
DKINIAKNHQNVHMTATYNNMDKNNANNNIIHLNNHINMTDDQNYFYNSTTNNKMNNTLKENNFNNNMNTVNNSFYHNTD
NNFLNFTRNQNEQDTYVNNNIINNFNNQNVDKNINNNNNNPNKNVESINKFNHIYNMQNFNHFIPNISNGKNGNLENNAS
LSHNVNSVSTISELHNFNYMNNMDLNNVDMNNMNMNNMNMNNMNMNNMNMNNMDMNNVNMNNMNMNNMDVNSMNMNNMDN
MNNMNMNNMDVNNMNMNNMDVNNMDNMNNMDNMNNMKNLSNFNNSYQYNSIPQFNSSSRFNNITHFNNGISHNVNNVSNF
SNNAHLDNSNNMNRLNAVNNFGDINSFHDPLNEMQVLNKNVNMQNENHFNVMNDEMKNYNNVKRINSISHIPYMNNLKNY
NEHTSMVKGKGNTNRKKSNNLKINNNPGSVNARAISENNQSTAHGNIPMGSVDKVIKHDRMDNDLKNINNMNNMNSMNNM
NSMNNMNNMINMNNMNNMNNMINMNNMNNMNNMNNMSNMNNTSILNNNNKKITKRGRAKKNSTININNINKMNSTNNKSS
MINMNSVNNMNSVNNMNSVKNMNSVNNMNSVNNINNVNNINNVNNINNVNNINNVNNINNVNNINNVNNINNVNNMNNMF
NVNPQLNIMGIMKDINNNNITVSNKNKLMNNYINDNNIMNMEGSINETYNFDGTLNNKNVSNNNNNDIHDKGVLNTLNRS
KSSSYIKPHRNLTLPINMYMNNTYMYNSKAYVNYENQNWMAQQDCNDKNGLSLNEGPRYNDNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNHSIINNNITQGIHRGSMINNQHFDELSYNPNGIFLEKNTITNYNEMLGSGYNNMYDKNAVKGNMNLIGK
HSNYDLMKNGNMINGYKLNMQEVQKGMNEVGKKRAPRRRAKTINLKSINRFNTVSLGLKGNHNMENMNNMDNMDNMNNMI
NVSNVNNVNNMNNVNNVNNMNNVNNMNNVNNMNNVNSVNNMNNTNNMNNMNNVNSVNNMNNTNNMNNMNNTNNMNNMNRM
NHIDNNMVTNLNYMDNKINNAGNNLNGEFSKRILYNRSKSTENIKEMMQPHNEANNISGNNTSDSNNITLNKNLVEMILR
NNKPSIDKNIHESVNRSYTSFLMNIGSSYLKKKKTAEIKTGENNTENNKGIVNVNSQVEEKGKSENKSILEIKKEGQIKN
VIYNNNNNNNEKDQNADQYQDQNKNHKQDQRQDQNKSHKQDQLHDQNQNQGQLHDQNQNQGQLHDQNQNQGQLHDQNINQ
GQLQNQNQNYYQNYYQNHYQNDHQNDHQNDHQNDHQNHYQNNHQNDHQNDHQNDHQNDHQNHYPYQYQDQGVSKEINNKE
IEENINKLNEESDENNNLEILDEEEITNKSVISNTMNMVELKNENKNEMMINDIKKEEEISAQIVEPVKKRGRKKGSKFV
HKNITNEHILSQLKEPKRKGRKRKIWIQPLDNYNKVEDNKLKEYTNNIDIRDDNKANTQNEDVTTNNVTTLCCNKKAKYE
SMNPNSIRNMFILLRNKLSNLNVKNTMNSHSEINMLINNFIYILKIMNKHKQMLENIYTINFTNIDDICVRNYLEKHFPF
IKGYRNKYEITDDLFMQGNDDNHLSKDINCINGNEDIGLNASCEQNEENENHEKSDMYNYKNDNSITNMEKSPNNITLVH
KNIKDEDNFETIFLKTRSSFSSVDSNIIHIDNTQNFKLSNSSENKLNQFEKKTVLLSNDILYDAKKEIEQSYMNSQEKEK
NYLH

Gene-Specific Links for PFB0540w

General Sub-Cellular Localisation Links