ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0480w (Stx1)

syntaxin, Qa-SNARE family, a gene from Plasmodium falciparum

Compiled localisation
proximal to plasma membrane during schizont

Who localised this protein by microscopy?

Parish, L. A., Rayner, J. C.
Plasmodium falciparum secretory pathway: characterization of PfStx1, a plasma membrane Qa-SNARE. (2009 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

proximal to plasma membrane during schizont
  • "Fig. 2. PfStx1 is localized proximal to the P. falciparum plasma membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: proximal to plasma membrane during schizont
  • Other genes localised in this publication: heat shock protein 70, merozoite surface protein 3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10340

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0480w syntaxin, Qa-SNARE family
MIDLFDHLKSLGIKKNKGNAKNMIQWFIFKKDKIIDNTVDLNEETILNIDNEKKSDLRIYVDKVDSIKMEIKKIQKNVDE
ISCLKNKINISITVEQENELSIELNKLIKDTNDLINIIKIDIRNLRKKYVLRSKESFYIKKAIYDNVINIFKKSLHTYQD
VQNIYHDGMKDKITRHIKIMYPNYSDEDISTFLNYDDINTQNLVKWKLQGHQDLKNALTDVETKYKDVKTLEKSVCDLHQ
TIIELSALIEMNDEIIDNIYDHVNDAQYFTEKANVDLIEARNIQKKTSKWMFYLTVTIIILILIIFFPIITKII

Gene-Specific Links for PFB0480w

General Sub-Cellular Localisation Links