ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0400w ()

6-cysteine protein, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during gametocyte stage v
during not emerged gametocyte

Who localised this protein by microscopy?

Eksi, S., Williamson, K. C.
Male-specific expression of the paralog of malaria transmission-blocking target antigen Pfs230, PfB0400w. (2002 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm during gametocyte stage v, during not emerged gametocyte
  • "Only a small fraction of the stage V gametocytes were recognized and the fluorescence pattern was diffuse and patchy, which is not consistent with the rim fluorescence pattern observed with surface antigens, such as Pfs230. The fluorescence pattern is more consistent with localized concentrations of the antigen in the cytoplasm. This pattern coupled with PfB0400w's secretory signal sequence suggests that it may be located in cytoplasmic vesicles. The stage V gametocytes that were positive for PfB0400w also stained with anti--tubulin II antibodies and exhibited diffuse nuclear staining with 4,6-diamidino-2-phenylindole (DAPI), suggesting that they were male gametocytes (Fig. 2A) [15. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during stage V gametocyte, not during after gametocyte emergence
  • Comment: strain information not found
  • Other genes localised in this publication: alpha tubulin 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42799

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0400w 6-cysteine protein
MFIYLFIYLFFKMDKKRTFYYLFFFFTFLVYVLYFDNIKSVLRSSTKKKKKKKICKSTFYVHEESEEIKSWLRNSNERDK
GKKFFIFERLIKERKYICVNKYKRNNKLKWIYKNTYEKTKNICDDYNILFKCIKGIIYDKNKETFFETFFENFWDNIFYM
NKYIFNIYYYMFDYTKKVKKKIEGIKENMNIRHNNNYNNIFYVHKFFLFNDDEEKKKRNDDIKINIKLHNNTRKLSVSEE
NVELKPYIKQGERNETVVNLYEYFTGGVKRSNNNNEIVVTSTEQFHRIVIICFKPTVKHSHIITSPHDALNHIVEENDKI
KLSEEIYSIPFYPIYGNLGLKNVITTGIVEFMIPYFSRTQMNFTVTCANGEMNDLYKFEDLIKIRIRIPRNTKKILGLST
NEKDKTVFERIVDNTSNEYRFKSYNNKIVGIKLENSILDPPGCFKTVYEDDKILQLEVFLQYVKCINLDRDNYKIRFFFL
PEDFGDEEIEFSCKFTYKKKTSKIIFGLGETSVDKDIFYLEDEHVKLNINQDISGDEPYYSHLNYNGIPYNICNFQYKSE
YDSQVCERTIHEFSLFIYNCDTLVGTQIQTTEPITSVKYLNSTYPINKFSDITLLSKDIDIEGLEEAFRNSKFFLTSYIN
HGPFPLIIECVISNSNKDYQNVYILLHLRTSIKNRSVSFCDFEKVQGYNYLNNYIDGKICNINITSNSVFGFRCPSNSIK
EPKDCFSQVYIDKKVYKLNDKLSNKLILYSMKQENLAIAGFNNYISNSFSFECYCIDKNQTYSSYERTSGEDIFNHIVKR
IHVHYKNYDELYDYNIHDKITYEPIMKNPPITYLCDFLNKKQILQPLNNKTKNYICTIWYPKPLNYIALNCPTNRRDEQN
DQTISEVYNSLQKDLLKPTGIEQQIDQKKKELNLLFNKRNIYSNLYHLPKNAPKRTINKNGLNIVNIDEIIPGILIKDVI
NMKLEDVIKPDLLTPTSFLHKTYNTNKSYLFSTRNKSTSVFNTPSIYTPLTHTSFSISPKSVPLTKSRIEETHSSSNTYE
QYIGKRNSIENGFFIFQLPPYLKKNQTIEFACINDSTIKNKNVGNNGIMTIHLKSFGNPIEGCYFYKNSAKYNYLKKSIK
IDDLKKEECTIRSDGEIEFVGIMCPYENNLYLTPSSCFLKTYDNTDNLVELLDINENFEYYSNDKGISYLKIPQEFLNHV
HLFCYCNVDKDSVSDTNVLVKKENKISLELNYSNKGFNIIKTIDYQYEADILIGYSYYFKRVTPIYRKKHICDFTTEDNS
LEPESEDKMIYSCYLSLENNLNFIEVKCPKNKKSSNSEWLFKYGTFDKSSEIMEDDENIKKYEHMKYMPEDKDEIIYLFK
KQKLEDILPGVIIFDKNRYFFEKGNFSFVTPLIVKEDVTIKLLCDNSETKIDDKIGKKGIILIKIPQHITDKKFYGCDFS
GDSNKKSSFYYTSVYDLKTQNQYCEVKLKENIIISLNCPNGNINPNNCFNNVFLKTNMNEQIHEKIQNIFDQVKVINTKS
HVLLNSSSTFLIISKITKKELNFFCTCHHNETKNVGTIYIKNEDIINFSKAYNKESSILQYIDVTPYYLKDTYICDFTQN
HYSISFDTSVNVQNVLERYLKILSDLYNTHEEFTYFSIHLKLKKEIMKKKYIDYLKKKINEYKEKETSDKIKRVTLSTND
NINTILVYRCNIDLGSFDKFKIKCPSKLNEEEVENNKLYPNLIYSSNLGLDETDMLNGLTKLLYGSVLINKTEKNVSFFE
KGELELIISPYTDSSKNIIFSCENVPRNLSKGIIGSASIFIKKNDNKILGCDFIDTPSTLSSASTLESSYGSHASSPLSS
SHHVLHNDNQGHDVHMINHIDISNKKNSFEFEIELIEGKNTYCNIEAIENDIVGFSCPYNFLTTPSDCFESIQIEGVDKE
LETHKLEKLLKGVKILNNDIYKYNFTPSYIILPKKIKKSLKIFCRCNSVKLIKTGIIQINIVGDDLNNWFKKEITHNIFA
YQKMDYFYDFSKGPTNISSENVLGISTMSLMSSNKKVSRKKNHKEENRTQQNVYKEIENDHKNINENVNKYDNLPVTLLS
SDEGDGYQADEDIGGEDDAEDVDGEGDDEDDNILNPLRTKQVYDIIVAASEFSKIEVVCPLRNSSQFRQSKISPENFFEY
VYVLEDKNDDKRKRSIEENEKLVKAILEGKKNIDGHIINIEDINNKKSSKNASVEYDDMGNKIFISIISEKPKAVIGDNI
SSSRSSVHISNNIMNSSFQSNIHPDPITSDTTTSEYEQYNSYFKDILVIKNINEVISFANIKIDINEQTYSSSLHIPPLI
LKDAEFLISCDNSLTLNENTRGKTATVKIKVKSNFLKIYGCDFVGEFSTHFLFSKKWDDIPKNYICKINIQDDMLIGLAC
PSFTKLHPPDCFENIIVNQNVYKKNIIMETKNMFFYKQNDKPILSFVHVKKILVETFLCKCYQVTKADYKEVTIQILYEP
YVMGTPKYTLEKSIIQYRYANLKPPLHI

Gene-Specific Links for PFB0400w

General Sub-Cellular Localisation Links