ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0385w (ACP)

acyl carrier protein, a gene from Plasmodium falciparum

Compiled localisation
apicoplast during early schizont and early trophozoite and extracellular merozoite and intraerythrocytic and late schizont and late trophozoite and ring and schizont and segmenter and trophozoite
not mitochondrion during early trophozoite and ring and schizont and trophozoite
nowhere except apicoplast during intraerythrocytic
not endoplasmic reticulum during early trophozoite and late schizont and late trophozoite

Who localised this protein by microscopy?

Read, M., Muller, I. B., Mitchell, S. L., Sims, P. F., Hyde, J. E.
Dynamic subcellular localization of isoforms of the folate pathway enzyme serine hydroxymethyltransferase (SHMT) through the erythrocytic cycle of Plasmodium falciparum. (2010, Malar J) PubMed / full text
   more detail about this publication

apicoplast
  • "The donated apicoplast-specific antibody, anti-acyl carrier protein (anti-ACP; IgG) was raised in rabbits [37], as were the donated antibodies against the cytoplasmic enzymes chorismate synthase and cyclin-dependent protein kinase 5 [38]."
  • Microscopy type: Fixed Light
  • Microscopy method: DsRed tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast
  • Other genes localised in this publication: serine hydroxymethyltransferase, putative, serine hydroxymethyltransferase, chorismate synthase, protein kinase 5

El Bakkouri, M., Pow, A., Mulichak, A., Cheung, K. L., Artz, J. D., Amani, M., Fell, S., de Koning-Ward, T. F., Goodman, C. D., McFadden, G. I., Ortega, J., Hui, R., Houry, W. A.
The Clp chaperones and proteases of the human malaria parasite Plasmodium falciparum. (2010 Dec 3, J Mol Biol) PubMed / full text
   more detail about this publication

apicoplast

Urscher, M., Przyborski, J. M., Imoto, M., Deponte, M.
Distinct subcellular localization in the cytosol and apicoplast, unexpected dimerization and inhibition of Plasmodium falciparum glyoxalases. (2010 Apr, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast during schizont and trophozoite
  • "To verify this, we carried out immunolocalization studies with antibodies raised against the acyl carrier protein (ACP), an apicoplast marker (Tonkin et al., 2004)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during trophozoite and schizont
  • Other genes localised in this publication: glyoxalase I, cytosolic glyoxalase II, targeted glyoxalase II

Kumar, A., Tanveer, A., Biswas, S., Ram, E. V., Gupta, A., Kumar, B., Habib, S.
Nuclear-encoded DnaJ homologue of Plasmodium falciparum interacts with replication ori of the apicoplast genome. (2010 Feb, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during trophozoite
  • "Transport of PfDnaJA to the apicoplast was indicated by colocalization of the protein with apicoplast-targeted GFP in the P. falciparum D10 ACPL-GFP line (Waller etᅠal., 2000) (Fig.ᅠ8C)"
  • Microscopy type: light
  • Microscopy method: GFP tag
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondrial during trophozoite
  • Other genes localised in this publication: heat shock protein 40

Prusty, D., Dar, A., Priya, R., Sharma, A., Dana, S., Choudhury, N. R., Rao, N. S., Dhar, S. K.
Single-stranded DNA binding protein from human malarial parasite Plasmodium falciparum is encoded in the nucleus and targeted to the apicoplast. (2010 Nov, Nucleic Acids Res) PubMed / full text
   more detail about this publication

apicoplast during ring and schizont and trophozoite
  • "Immuno-colocalization of PfSSB and apicoplast marker acyl carrier protein (ACP)."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during ring and troph and schizont
  • Other genes localised in this publication: single-strand binding protein, putative

Tschan, S., Kreidenweiss, A., Stierhof, Y. D., Sessler, N., Fendel, R., Mordmuller, B.
Mitochondrial localization of the threonine peptidase PfHslV, a ClpQ ortholog in Plasmodium falciparum. (2010 Nov, Int J Parasitol) PubMed / full text
   more detail about this publication

apicoplast
  • "MitoTracker specifically accumulates in mitochondria and anti-ACP antibody stains the apicoplast."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast
  • Comment: stage information not found
  • Other genes localised in this publication: heat shock protein hslv

Rathore, S., Sinha, D., Asad, M., Bottcher, T., Afrin, F., Chauhan, V. S., Gupta, D., Sieber, S. A., Mohmmed, A.
A cyanobacterial serine protease of Plasmodium falciparum is targeted to the apicoplast and plays an important role in its growth and development. (2010 Jun 10, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast during early schizont and trophozoite
  • "The anti-ACP antibody staining was found to be co-localized with the GFP fluorescence in these parasites, suggesting clearly that the PfClpP-GFP fusion protein is localized in the parasite apicoplst (Figure 2A)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during trophozoite and early schizont
  • Other genes localised in this publication: ATP-dependent Clp protease proteolytic subunit

Gratraud, P., Huws, E., Falkard, B., Adjalley, S., Fidock, D. A., Berry, L., Jacobs, W. R. Jr, Baird, M. S., Vial, H., Kremer, L.
Oleic acid biosynthesis in Plasmodium falciparum: characterization of the stearoyl-CoA desaturase and investigation as a potential therapeutic target. (2009, PLoS One) PubMed / full text
   more detail about this publication

apicoplast and not endoplasmic reticulum during early trophozoite and late schizont and late trophozoite

Kalanon, M., Tonkin, C. J., McFadden, G. I.
Characterization of two putative protein translocation components in the apicoplast of Plasmodium falciparum. (2009 Aug, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast
  • "Confocal image of chemically fixed PfTic22-HA-carrying parasites labelled with anti-HA (green) and anti-ACP antibodies (red), showing that PfTic22-HA is associated with ACP (merge), but is localized to the periphery."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast
  • Other genes localised in this publication: apicoplast TIC22 precursor, DER1-like protein

Spork, S., Hiss, J. A., Mandel, K., Sommer, M., Kooij, T. W., Chu, T., Schneider, G., Maier, U. G., Przyborski, J. M.
An unusual ERAD-like complex is targeted to the apicoplast of Plasmodium falciparum. (2009 Aug, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast

Charneau, S., Bastos, I. M., Mouray, E., Ribeiro, B. M., Santana, J. M., Grellier, P., Florent, I.
Characterization of PfDYN2, a dynamin-like protein of Plasmodium falciparum expressed in schizonts. (2007 Jun, Microbes Infect) PubMed / full text
   more detail about this publication

apicoplast during schizont
  • "Merged images of PfDYN2 (green) and the ER PfBIP (red, df), the apicoplast PfACP (red, gi) and the Golgi apparatus PfERD2 (red, jl)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: FcB1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during schizont
  • Other genes localised in this publication: dynamin-like protein, heat shock protein 70, ER lumen protein retaining receptor

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

apicoplast

Dar, M. A., Sharma, A., Mondal, N., Dhar, S. K.
Molecular cloning of apicoplast-targeted Plasmodium falciparum DNA gyrase genes: unique intrinsic ATPase activity and ATP-independent dimerization of PfGyrB subunit. (2007 Mar, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intraerythrocytic
  • "In panels 1and 2, PfACP (green) and PfGyrB (red) are colocalized to the apicoplast."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during asexual
  • Other genes localised in this publication: DNA gyrase subunit B, DNA gyrase subunit A

Ponpuak, M., Klemba, M., Park, M., Gluzman, I. Y., Lamppa, G. K., Goldberg, D. E.
A role for falcilysin in transit peptide degradation in the Plasmodium falciparum apicoplast. (2007 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast during ring and schizont and segmenter and trophozoite
  • "Immunoelectron microscopy analysis of FLNapicoplast association. Clone MP3 parasites were labelled with rabbit anti-ACP (18nm gold particles, blue arrow) and goat anti-GFP (12nm gold particles, red arrow) antibodies."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: MP3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during ring and troph and schizont and segmenter
  • Other genes localised in this publication: falcilysin, heat shock protein 60

Mullin, K. A., Lim, L., Ralph, S. A., Spurck, T. P., Handman, E., McFadden, G. I.
Membrane transporters in the relict plastid of malaria parasites. (2006 Jun 20, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

apicoplast during intraerythrocytic
  • "Anti-PfiTPT (red) colocalizes with apicoplast-targeted GPF (green) in parasites expressing PfACP(leader)-GFP (18)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during asexual
  • Other genes localised in this publication: triose phosphate transporter, triose phosphate transporter

Seow, F., Sato, S., Janssen, C. S., Riehle, M. O., Mukhopadhyay, A., Phillips, R. S., Wilson, R. J., Barrett, M. P.
The plastidic DNA replication enzyme complex of Plasmodium falciparum. (2005 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during early trophozoite and schizont
  • "Ring stage parasites of P. falciparum 3D7 were transfected by electroporation [28 and [29 with the resulting plasmid (pSSPF2/PfPREX-GFP) alone, or in combination with pSSPF2/PfACP-DsRED [30 that encodes the red fluorescent protein DsRED fused to the specific apicoplast-localizing acyl carrier protein targeting sequence [31 "
  • Microscopy type: Light
  • Microscopy method: DsRed tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondria during early troph and schizont
  • Other genes localised in this publication: plastid replication-repair enzyme

Sato, S., Wilson, R. J.
Organelle-specific cochaperonins in apicomplexan parasites. (2005 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during ring and schizont
  • "Parasites transfected with this construct expressed DsRED in an organelle-like compartment (Fig. 3D) different from the mitochondrion that was specifically stained with MitoTracker Green. This was confirmed in parasites that were double-transfected with both the PfCpn20-DsRED gene and the PfACP-GFP gene."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondria during ring and schizont
  • Other genes localised in this publication: 10 kd chaperonin, cochaperonin, heat shock protein 60

Foth, B. J., Stimmler, L. M., Handman, E., Crabb, B. S., Hodder, A. N., McFadden, G. I.
The malaria parasite Plasmodium falciparum has only one pyruvate dehydrogenase complex, which is located in the apicoplast. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

nowhere except apicoplast during intraerythrocytic
  • "Colocalization with the apicoplast-resident protein ACP using -ACP antibodies unambiguously shows that the presequences of PDH subunits E1 and E2 are sufficient to target proteins exclusively to the apicoplast (A and C)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast only during asexual
  • Other genes localised in this publication: pyruvate dehydrogenase E1 alpha subunit, dihydrolipoamide acyltransferase component E2

McMillan, P. J., Stimmler, L. M., Foth, B. J., McFadden, G. I., Muller, S.
The human malaria parasite Plasmodium falciparum possesses two distinct dihydrolipoamide dehydrogenases. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during ring and schizont and trophozoite
  • "Colocalization with antibodies directed against the apicoplast-resident acyl-carrier protein (ACP; A) and with MitoTracker Red (B) demonstrates that the putative apicoplast targeting presequence of aLipDH targets the marker protein GFP exclusively to the apicoplast. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Apicoplast and not mitochondria during ring and troph and schizont
  • Other genes localised in this publication: lipoamide dehydrogenase, lipoamide dehydrogenase, heat shock protein 60

Tonkin, C. J., van Dooren, G. G., Spurck, T. P., Struck, N. S., Good, R. T., Handman, E., Cowman, A. F., McFadden, G. I.
Localization of organellar proteins in Plasmodium falciparum using a novel set of transfection vectors and a new immunofluorescence fixation method. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast

Sato, S., Wilson, R. J.
The use of DsRED in single- and dual-color fluorescence labeling of mitochondrial and plastid organelles in Plasmodium falciparum. (2004 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during schizont and trophozoite
  • "The resulting plasmid pSSPF2/PfACP-DsRED encodes DsRED supposed to be targeted to the plastid. "
  • Microscopy type: Light
  • Microscopy method: DsRed tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondria during troph and schizont
  • Other genes localised in this publication: chaperonin, cpn60, heat shock protein 60

Sato, S., Clough, B., Coates, L., Wilson, R. J.
Enzymes for heme biosynthesis are found in both the mitochondrion and plastid of the malaria parasite Plasmodium falciparum. (2004 Mar, Protist) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during schizont and trophozoite

Sato, S., Rangachari, K., Wilson, R. J.
Targeting GFP to the malarial mitochondrion. (2003 Aug 31, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during schizont and trophozoite
  • "GFP expressed from the pSSPF2/PfACP-GFP was accurately localized to the plastid, separate from the compartment stained by MTR"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondria during troph and schizont
  • Other genes localised in this publication: heat shock protein 60, cysteine desulfurase, putative

Foth, B. J., Ralph, S. A., Tonkin, C. J., Struck, N. S., Fraunholz, M., Roos, D. S., Cowman, A. F., McFadden, G. I.
Dissecting apicoplast targeting in the malaria parasite Plasmodium falciparum. (2003 Jan 31, Science) PubMed / full text
   more detail about this publication

apicoplast during ring
  • "(A) Apicoplast targeting of the wild-type ACP leader."
  • Microscopy type: Light
  • Microscopy method: GFP tag after 40 amino acids
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Apicoplast during rings
  • Comment: strain information not found
  • Other genes localised in this publication: -

Waller, R. F., Reed, M. B., Cowman, A. F., McFadden, G. I.
Protein trafficking to the plastid of Plasmodium falciparum is via the secretory pathway. (2000 Apr 17, EMBO J) PubMed / full text
   more detail about this publication

apicoplast during early schizont and early trophozoite and extracellular merozoite and late schizont and late trophozoite and ring
  • "Plasmodium falciparum expressing apicoplast-targeted GFP in human erythrocytes."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during ring and small troph and large troph and early schizont and late schizont and free merozoite
  • Other genes localised in this publication: beta-ketoacyl-ACP synthase III

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10539

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0385w acyl carrier protein
MKILLLCIIFLYYVNAFKNTQKDGVSLQILKKKRSNQVNFLNRKNDYNLIKNKNPSSSLKSTFDDIKKIISKQLSVEEDK
IQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ

Gene-Specific Links for PFB0385w

General Sub-Cellular Localisation Links