ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0310c (MSP-4, MSP4)

merozoite surface protein 4, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during late schizont and merozoite and schizont

Who localised this protein by microscopy?

Gao, Y. H., Li, H. L., Lu, Y., Gao, F. M., Lin, Y. H., Zhou, H. C., Zhang, L. H., Wang, H.
Identification of a vaccine candidate antigen, PfMAg-1, from Plasmodium falciparum with monoclonal antibody M26-32. (2009 Nov, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "PfMSP-1 (Holder et al. 1985) and PfMSP-4 (Smythe et al. 1988) are two of the major merozoite surface proteins characterized."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: ag-1 blood stage membrane protein homologue, merozoite surface protein 1

Sanders, P. R., Cantin, G. T., Greenbaum, D. C., Gilson, P. R., Nebl, T., Moritz, R. L., Yates, J. R. 3rd, Hodder, A. N., Crabb, B. S.
Identification of protein complexes in detergent-resistant membranes of Plasmodium falciparum schizonts. (2007 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during schizont
  • "MSP-4 is located on the merozoite surface"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from U85260, annotation matches
  • Localisation record: surface during schizont
  • Comment: strain information not found
  • Other genes localised in this publication: 6-cysteine protein

Pearce, J. A., Mills, K., Triglia, T., Cowman, A. F., Anders, R. F.
Characterisation of two novel proteins from the asexual stage of Plasmodium falciparum, H101 and H103. (2005 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during late schizont

Marshall, V. M., Silva, A., Foley, M., Cranmer, S., Wang, L., McColl, D. J., Kemp, D. J., Coppel, R. L.
A second merozoite surface protein (MSP-4) of Plasmodium falciparum that contains an epidermal growth factor-like domain. (1997 Nov, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during schizont
  • "Evidence for the surface location of MSP-4 includes (i) a staining pattern that is consistent with merozoite surface location in indirect immunofluorescent studies of cultured parasites"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitope 43-107
  • Strain:
  • Gene model mapping comments: Blast from U85260, annotation matches
  • Localisation record: surface during schizont
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48471

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0310c merozoite surface protein 4
MWIVKFLIVVHFFIICTINFDKLYISYSYNIVPENGRMLNMRILGEEKPNVDGVSTSNTPGGNESSSASPNLSDAAEKKD
EKEASEQGEESHKKENSQESANGKDDVKEEKKTNEKKDDGKTDKVQEKVLEKSPKESQMVDDKKKTEAIPKKVVQPSSSN
SGGHVGEEEDHNEGEGEHEEEEEHEEDDDDEDDDTYNKDDLEDEDLCKHNNGGCGDDKLCEYVGNRRVKCKCKEGYKLEG
IECVELLSLASSSLNLIFNSFITIFVVILLIN

Gene-Specific Links for PFB0310c

General Sub-Cellular Localisation Links