ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0305c-b ()

merozoite surface protein 5, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_57714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0305c-b merozoite surface protein 5
MNGHTHILNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNENELKEEGSLPTKMNEKNSNSSDKQPNDISHDE
SKSNSNNSQNIQKEPEEKENSNPNLDSSENSSESATRSVDISEHNSNNPETKEENGEEPLDLEINENAEIGQEPPNRLHF
DNVDDEVPHYSALRYNKVEKNVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGYLLGTKCIILNS
YSCHPFFSILIYITLFLLLFV

Gene-Specific Links for PFB0305c-b

General Sub-Cellular Localisation Links