ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0305c-a (MSP-5)

merozoite surface protein 5, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during merozoite

Who localised this protein by microscopy?

Sanders, P. R., Kats, L. M., Drew, D. R., O'Donnell, R. A., O'Neill, M., Maier, A. G., Coppel, R. L., Crabb, B. S.
A set of glycosylphosphatidyl inositol-anchored membrane proteins of Plasmodium falciparum is refractory to genetic deletion. (2006 Jul, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "Here, merozoite surface localization of MSP-5 was confirmed by colocalization with MSP-1 in IFA utilizing a rabbit polyclonal MSP-5 antibody (Fig. 5)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 17553576, annotation matches
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_57714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0305c-a merozoite surface protein 5
MNILCILSYIYFFVIFYSLNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNENELKEEGSLPTKMNEKNSNSS
DKQPNDISHDESKSNSNNSQNIQKEPEEKENSNPNLDSSENSSESATRSVDISEHNSNNPETKEENGEEPLDLEINENAE
IGQEPPNRLHFDNVDDEVPHYSALRYNKVEKNVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGY
LLGTKCIILNSYSCHPFFSILIYITLFLLLFV

Gene-Specific Links for PFB0305c-a

General Sub-Cellular Localisation Links