ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0300c (MSP-2, Ag513)

merozoite surface protein 2, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during schizont

Who localised this protein by microscopy?

Smythe, J. A., Coppel, R. L., Brown, G. V., Ramasamy, R., Kemp, D. J., Anders, R. F.
Identification of two integral membrane proteins of Plasmodium falciparum. (1988 Jul, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

merozoite surface during schizont
  • "A grape-like pattern was observed on seg-mented schizonts (Fig. 2, a and b), a characteristic pattern noted previously with a MSA (1)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: FC27
  • Gene model mapping comments: Blast from J03828, annotation matches, blast from L07944
  • Localisation record: merozoite surface during schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10010

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0300c merozoite surface protein 2
MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESKPSTGAGGSAGGSAGGSAGGSAGGSAGGSAGSGD
GNGADAEGSSSTPATTTTTKTTTTTTTTNDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTK
SNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAA
TSLLNNSSNIASINKFVVLISATLVLSFAIFI

Gene-Specific Links for PFB0300c

General Sub-Cellular Localisation Links