ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0295w ()

adenylosuccinate lyase, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13938

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0295w adenylosuccinate lyase
MDVHVNQLKNISPIDGRYKRSCQEVSEYFSEYALIKYRIIVEIKWLLFLNDKEYFFPKVSEKSLSNITSIMELINDNDIL
RVKKIEEETNHDVKAVEYFIREKLESLKNEEITKVIPYVHYLCTSEDINNIAYGLCLYNCIHNIIIPNIQNIIDKLKEFS
FNYSDVSLLSKTHGQPASPTTFGKEMSNYYYRLYKHINKLKNIEIYVKFNGAVGNFNAHKVCDPNIDWIDNIKYFIETYF
NLHFSLYCTQIQDHDYICEISDTLARLNYTLIDLSVDMWLYISSNVLKLKVIQKEIGSSTMPHKVNPIDFENAEGNLHLA
NSLFKLFSSKLPISRLQRDLSDSTVLRNLGSSFAYSLISYKSLLRGLNKIDVDQNVMNEQLNQNWCTLAEPIQIIMKKYN
IADSYEQLKNFTRGKSIDKQCMYQFIQQNCSHLPKNAIDELMNLTPHNYLGYASYLSKNVEHFSQEYIKKN

Gene-Specific Links for PFB0295w

General Sub-Cellular Localisation Links