ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0200c (AspAT)

aspartate aminotransferase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Wrenger, C., Muller, I. B., Schifferdecker, A. J., Jain, R., Jordanova, R., Groves, M. R.
Specific inhibition of the aspartate aminotransferase of Plasmodium falciparum. (2011 Jan 28, J Mol Biol) PubMed / full text
   more detail about this publication

cytosol during ring and schizont and trophozoite
  • "We also report on the localization of PfAspAT to the parasite cytosol"
  • Microscopy type: Live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: blast from PDB 3K7Y, annotation matches
  • Localisation record: cytosol during ring and trophozoite and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10189

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_030230 aspartate aminotransferase, putative
  • PY00897 aminotransferase, classes I and II, putative
  • PVX_003655 aspartate aminotransferase, mitochondrial precursor, putative
  • PCHAS_030450 aspartate aminotransferase, putative
  • PKH_041530 aspartate aminotransferase, putative
  • TGME49_048600 aspartate aminotransferase, putative
  • NCLIV_064760 Contig An16c0190, complete genome. (EC 2.6.1.1) (Precursor), related
  • TP02_0046 aspartate aminotransferase, putative
  • TA12970 aspartate aminotransferase, cytoplasmic, putative
  • BBOV_III010960 aminotransferase, classes I and II family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFB0200c aspartate aminotransferase
MDKLLSSLENIEVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADKLVTENYKEKPYLLGNGTEDFSTL
TQNLIFGNNSKYIEDKKICTIQCIGGTGAIFVLLEFLKMLNVETLYVTNPPYINHVNMIESRGFNLKYINFFDYNLIDIN
YDLFLNDLRNIPNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNLEEDVLLIRKFEEKNIA
FSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKELSQLSQR
ITNNRILFFNKLETYQKKYNLNYDWNVYKKQRGLFSFVPLLAKIAEHLKTHHIYIINNGRINVSGITKNNVDYIADKICL
SLSQI

Gene-Specific Links for PFB0200c

General Sub-Cellular Localisation Links