ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0120w (ETRAMP2, Etramp 2, Etramp2)

early transcribed membrane protein 2, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole membrane and parasitophorous vacuole during ring
not erythrocyte plasma membrane and not parasite plasma membrane

Who localised this protein by microscopy?

Luah, Y. H., Chaal, B. K., Ong, E. Z., Bozdech, Z.
A moonlighting function of Plasmodium falciparum histone 3, mono-methylated at lysine 9? (2010, PLoS One) PubMed / full text
   more detail about this publication

parasitophorous vacuole during ring

Spielmann, T., Gardiner, D. L., Beck, H. P., Trenholme, K. R., Kemp, D. J.
Organization of ETRAMPs and EXP-1 at the parasite-host cell interface of malaria parasites. (2006 Feb, Mol Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during ring
  • "C and D. Immunofluorescence analysis in acetone-fixed IRBCs: the tagged transgenes detected via the myc tag colocalize with the respective chromosomally derived ETRAMPs in a typical peripheral staining in the transfected parasites D10E2myc (C) and D10E4myc (D)."
  • Microscopy type: Light
  • Microscopy method: myc tag, polyclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during ring
  • Other genes localised in this publication: early transcribed membrane protein 4, early transcribed membrane protein 10.1

Spielmann, T., Fergusen, D. J., Beck, H. P.
etramps, a new Plasmodium falciparum gene family coding for developmentally regulated and highly charged membrane proteins located at the parasite-host cell interface. (2003 Apr, Mol Biol Cell) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane and not erythrocyte plasma membrane and not parasite plasma membrane

Orthology

OrthoMCL

Part of OrthoMCL group OG4_54905

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PY00205 early transcribed membrane protein family
  • PVX_003565 early transcribed membrane protein (ETRAMP)
  • PKH_041730 early transcribed membrane protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0120w early transcribed membrane protein 2
MKLSKILYFFAALLALNFIAPRDYNSMVEAKPAKKLTPAERKKRNQNIMIYSSIASAVALLIGGAVGLGIHLHKNNKGDN
KKGTPGAKKNDNKAVNPSISSTMYRA

Gene-Specific Links for PFB0120w

General Sub-Cellular Localisation Links