ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0106c ()

Plasmodium exported protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm and maurer's cleft

Who localised this protein by microscopy?

Maier, A. G., Rug, M., O'Neill, M. T., Brown, M., Chakravorty, S., Szestak, T., Chesson, J., Wu, Y., Hughes, K., Coppel, R. L., Newbold, C., Beeson, J. G., Craig, A., Crabb, B. S., Cowman, A. F.
Exported proteins required for virulence and rigidity of Plasmodium falciparum-infected human erythrocytes. (2008 Jul 11, Cell) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm and maurer's cleft

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PFB0106c Plasmodium exported protein, unknown function
MVNKDNRKIHKAHISRYVGYRKREMNNTFFSKSYKLFFSNNKYEYSKDEEKKNIYPLSLKLLILTVFICILQFSNNNGYF
EKYVNKNSGNDNEYYFNIKYNRSLAELKKRIGAIREMINNDSFGTVFKNHLPLPASITKGDSEAEAGGNDSRNTSEKAVS
SSNDDNNTNDEGKDKRKLKGICKVKKLMGLSKICGNKSGKSNLQLQKALDILEIIFEQVSKALPFILPFVPPFMVYKYGY
AKTYVMLYTFNLIHAMFKWAILLRNMLMKSKQRRNEALREQDDNLNIQNQ

Gene-Specific Links for PFB0106c

General Sub-Cellular Localisation Links