ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFB0100c (KAHRP, HRP1)

knob-associated histidine-rich protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte plasma membrane during ring and schizont and trophozoite
parasite plasma membrane during schizont and trophozoite
erythrocyte cytoplasm and food vacuole during late trophozoite
parasitophorous vacuole during early trophozoite and late trophozoite and ring and trophozoite
not erythrocyte cytoplasm during early trophozoite and ring
erythrocyte cytosol during early schizont
cytoplasmic side of erythrocyte membrane and maurer's cleft

Who localised this protein by microscopy?

Kulzer, S., Rug, M., Brinkmann, K., Cannon, P., Cowman, A., Lingelbach, K., Blatch, G. L., Maier, A. G., Przyborski, J. M.
Parasite-encoded Hsp40 proteins define novel mobile structures in the cytosol of the P. falciparum-infected erythrocyte. (2010 Oct, Cell Microbiol) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane and maurer's cleft

Waller, K. L., McBride, S. M., Kim, K., McDonald, T. V.
Characterization of two putative potassium channels in Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

parasite plasma membrane during schizont and trophozoite

Marti, M., Good, R. T., Rug, M., Knuepfer, E., Cowman, A. F.
Targeting malaria virulence and remodeling proteins to the host erythrocyte. (2004 Dec 10, Science) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during late trophozoite, parasitophorous vacuole and not erythrocyte cytoplasm during early trophozoite and ring
  • "Representative cells expressing the exported reporter (+Pexel) are shown in ring stage (left), early (center), and late trophozoites (right). Note that KAHRP-GFP is already exported into the host cell in early stages, whereas GBP130-YFP is retained in the parasitophorous vacuole and released after development into mature trophozoite stages, perhaps because of its unusually recessed or embedded signal sequence (see also fig. S3)."
  • Microscopy type:
  • Microscopy method:
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Cytoplasm during late troph, PV and not erythrocyte cytoplasm during ring and early troph
  • Other genes localised in this publication: glycophorin binding protein, erythrocyte membrane protein 1, PfEMP1

Wickham, M. E., Culvenor, J. G., Cowman, A. F.
Selective inhibition of a two-step egress of malaria parasites from the host erythrocyte. (2003 Sep 26, J Biol Chem) PubMed / full text
   more detail about this publication

erythrocyte cytosol during early schizont
  • "Transgenic parasites expressing this construct traffic the GFP fusion into the erythrocyte cytosol throughout the asexual lifecycle via an extension of the parasite's canonical secretory pathway in the host cell."
  • Microscopy type: Live light
  • Microscopy method: GFP tag after 123 amino acids
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: host erythrocyte cytosol during early schizogony
  • Other genes localised in this publication: S-antigen

Wickham, M. E., Rug, M., Ralph, S. A., Klonis, N., McFadden, G. I., Tilley, L., Cowman, A. F.
Trafficking and assembly of the cytoadherence complex in Plasmodium falciparum-infected human erythrocytes. (2001 Oct 15, EMBO J) PubMed / full text
   more detail about this publication

parasitophorous vacuole during late trophozoite and ring and trophozoite, food vacuole during late trophozoite, cytoplasmic side of erythrocyte membrane and erythrocyte cytosol
  • "The KAHRP(-His)GFP-expressing parasites, 3D7-His, traffic GFP to the parasitophorous vacuole, showing a 'necklace of beads' pattern in ring stages (A). In trophozoite stages, distortions and evaginations of the parasitophorous vacuole can be observed (B and C). In late trophozoites, GFP can be seen in association with the parasitophorous vacuole and the food vacuole (arrow) (D). Schizonts show a 'bunch of grapes' pattern (E). KAHRP(+His)GFP-expressing parasites, 3D7+His, traffic GFP to the parasitophorous vacuole early in development (i.e. early ring stages, F). In later stages, the chimeric protein is located in the host cell cytoplasm (GJ). The trafficking appeared to involve transit through the parasitophorous vacuole to foci in the erythrocyte cytosol (G and H). The foci then appeared to dissipate, and the GFP chimera became concentrated at the cytoplasmic side of the erythrocyte plasma membrane (I and J). "
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF275687, annotation matches, mRNA not properly spliced before sequencing
  • Localisation record: PV during ring and trophozoite, PV and FV during late troph, foci in erythrocyte cytosol, cytoplasmic side of erythrocyte membrane
  • Other genes localised in this publication: -

Magowan, C., Coppel, R. L., Lau, A. O., Moronne, M. M., Tchernia, G., Mohandas, N.
Role of the Plasmodium falciparum mature-parasite-infected erythrocyte surface antigen (MESA/PfEMP-2) in malarial infection of erythrocytes. (1995 Oct 15, Blood) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during trophozoite
  • "The reactivity of MoAb 89 was localized at the erythrocyte membrane in a punctate pattern in normal erythrocytes, as previously described, 6 and also in the 4.1-deficient erythrocytes (Fig 4)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Plasma membrane during troph
  • Comment: strain information not found
  • Other genes localised in this publication: mature parasite-infected erythrocyte surface antigen,erythrocyte membrane protein 2

Pasloske, B. L., Baruch, D. I., Ma, C., Taraschi, T. F., Gormley, J. A., Howard, R. J.
PfEMP3 and HRP1: co-expressed genes localized to chromosome 2 of Plasmodium falciparum. (1994 Jun 24, Gene) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during ring and schizont and trophozoite
  • "Analysis of PfEMP3 and HRP1 by immunofluorescence assay (IFA) revealed identical staining patterns of fixed PE at all stages of the asexual life cycle. Hence, PfEMP3 and HRP1 are adjacent to each other in chromosome 2, co-expressed temporally and their gene products co-localized to the PE membrane."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: RBC membrane during blood stages
  • Comment: fulltext not available online
  • Other genes localised in this publication: erythrocyte membrane protein 3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26765

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_003520 histidine-rich knob protein homolog KPRPC, putative
  • PKH_131750 histidine-rich knob protein (fragment)
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFB0100c knob-associated histidine-rich protein
MKSFKNKNTLRRKKAFPVFTKILLVSFLVWVLKCSNNCNNGNGSGDSFDFRNKRTLAQKQHEHHHHHHHQHQHQHQAPHQ
AHHHHHHGEVNHQAPQVHQQVHGQDQAHHHHHHHHHQLQPQQPQGTVANPPSNEPVVKTQVFREARPGGGFKAYEEKYES
KHYKLKENVVDGKKDCDEKYEAANYAFSEECPYTVNDYSQENGPNIFALRKRFPLGMNDEDEEGKEALAIKDKLPGGLDE
YQNQLYGICNETCTTCGPAAIDYVPADAPNGYAYGGSAHDGSHGNLRGHDNKGSEGYGYEAPYNPGFNGAPGSNGMQNYV
PPHGAGYSAPYGVPHGAAHGSRYSSFSSVNKYGKHGDEKHHSSKKHEGNDGEGEKKKKSKKHKDHDGEKKKSKKHKDNED
AESVKSKKHKSHDCEKKKSKKHKDNEDAESVKSKKSVKEKGEKHNGKKPCSKKTNEENKNKEKTNNSKSDGSKAHEKKEN
ETKNTAGENKKVDSTSADNKSTNAATPGAKDKTQGGKTDKTGASTNAATNKGQCAAEGATKGATKEASTSKEATKEASTS
KEATKEASTSKEATKEASTSKGATKEASTTEGATKGASTTAGSTTGATTGANAVQSKDETADKNAANNGEQVMSRGQAQL
QEAGKKKKKRGCCG

Gene-Specific Links for PFB0100c

General Sub-Cellular Localisation Links