ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0670c (GEXP10)

Plasmodium exported protein (hyp8), unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm during gametocyte stage i and gametocyte stage ii and gametocyte stage iii and gametocyte stage iv

Who localised this protein by microscopy?

Silvestrini, F., Lasonder, E., Olivieri, A., Camarda, G., van Schaijk, B., Sanchez, M., Younis Younis, S., Sauerwein, R., Alano, P.
Protein export marks the early phase of gametocytogenesis of the human malaria parasite Plasmodium falciparum. (2010 Jul, Mol Cell Proteomics) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during gametocyte stage i and gametocyte stage ii and gametocyte stage iii and gametocyte stage iv
  • "Specific staining in the erythrocyte cytoplasm was barely observable in stage I gametocytes, and it was far more evident in later maturation stages, indicating that the PfGEXP10 protein is indeed exported in the erythrocyte cytoplasm during gametocyte development."
  • Microscopy type: fixed light
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Barely erythrocyte cytoplasm during stage I gametocyte, erythrocyte cytoplasm during stage II gametocyte and stage III gametocyte and stage IV gametocyte
  • Other genes localised in this publication: male development gene 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118683

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0670c Plasmodium exported protein (hyp8), unknown function
MNIYIRTIFFAPFICLLIFSSNHGLFQKKDNQNCNSHKFCLNCSGSYLKNSRWLSETSVSYSDEGEPLKYGANDNNYDSN
LLKSEEQKQEISEHMKMLIKLYIDSSHDSAKEEKLFQQVKKYFKNNEYKDFMRTFIKVIKIHNDLTHLKKQMASTEKRYR
IISCVAAFLSTVSLAFTVVMLSTLNLKNENVIVTIILGLLGFIISLPVISYILSPYLNSSLEKGYRIADLYSEKILRQIL
HFQ

Gene-Specific Links for PFA0670c

General Sub-Cellular Localisation Links