ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0590w (MRP, MRP1)

ABC transporter, (CT family), putative, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during early schizont and gametocyte stage iii and gametocyte stage iv and gametocyte stage v and ring and schizont and trophozoite
not food vacuole during early schizont and merozoite and ring and schizont and trophozoite
not endoplasmic reticulum and not erythrocyte plasma membrane during early schizont and ring and schizont and trophozoite
not parasite plasma membrane and vesicle during merozoite
membrane structure during schizont and trophozoite
straight side of d shaped parasite during gametocyte stage ii
internal membrane networks during gametocyte stage iii and gametocyte stage iv and gametocyte stage v

Who localised this protein by microscopy?

Raj, D. K., Mu, J., Jiang, H., Kabat, J., Singh, S., Sullivan, M., Fay, M. P., McCutchan, T. F., Su, X. Z.
Disruption of a Plasmodium falciparum multidrug resistance-associated protein (PfMRP) alters its fitness and transport of antimalarial drugs and glutathione. (2009 Mar 20, J Biol Chem) PubMed / full text
   more detail about this publication

vesicle and not food vacuole and not parasite plasma membrane during merozoite, membrane structure during schizont and trophozoite, parasite plasma membrane during gametocyte stage iii and gametocyte stage iv and gametocyte stage v and schizont and trophozoite, straight side of d shaped parasite during gametocyte stage ii, internal membrane networks during gametocyte stage iii and gametocyte stage iv and gametocyte stage v
  • "PfMRP was localized on the parasite surface membrane, within membrane-bound vesicles, and along the straight side of the D-shaped stage II gametocytes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: membrane bound vesicles and not plasma membrane and not food vacuole during merozoite, membrane structure and plasma membrane during troph and schizont, straight side of D shaped parasite during stage II gametocyte, plasma membrane and internal membrane networks during stage III gametocyte and stage IV gametocyte and stage V gametocyte
  • Other genes localised in this publication: merozoite surface protein 1, chloroquine resistance transporter, male development gene 1

Kavishe, R. A., van den Heuvel, J. M., van de Vegte-Bolmer, M., Luty, A. J., Russel, F. G., Koenderink, J. B.
Localization of the ATP-binding cassette (ABC) transport proteins PfMRP1, PfMRP2, and PfMDR5 at the Plasmodium falciparum plasma membrane. (2009, Malar J) PubMed / full text
   more detail about this publication

parasite plasma membrane and not endoplasmic reticulum and not erythrocyte plasma membrane and not food vacuole during early schizont and ring and schizont and trophozoite
  • "PfMRP1 localized to the parasites plasma membrane and no signal was observed on the erythrocyte membrane or in the region around the food vacuole. PfMRP1 did not co-localize with PfERC, thus suggesting the absence of PfMRP1 on the endoplasmic reticulum membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitope CSNNNHLQNPDAFY and YASGIIKLYKEKNYV
  • Strain: NF54
  • Gene model mapping comments: Taken directly from paper, blast from epitope YASGIIKLYKEKNYV, annotation matches
  • Localisation record: PPM and not FV and not erythrocyte membrane and not ER during rings and early schizont and schizont and troph
  • Comment: no pubmed id yet
  • Other genes localised in this publication: ABC transporter, (CT family), ABC transporter (MDR family), putative, endoplasmic reticulum-resident calcium binding protein

Klokouzas, A., Tiffert, T., van Schalkwyk, D., Wu, C. P., van Veen, H. W., Barrand, M. A., Hladky, S. B.
Plasmodium falciparum expresses a multidrug resistance-associated protein. (2004 Aug 13, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

parasite plasma membrane and not food vacuole during schizont
  • "Using confocal microscopy the protein was seen to be localised at the edge of the schizonts with no obvious staining of the food vacuole."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitopes CSNNNHLQNPDAFY and YASGIIKLYKEKNYV
  • Strain: A4
  • Gene model mapping comments: Blast from CAB63558, annotation matches
  • Localisation record: Parasite Plasma Membrane and not food vacuole during schizonts
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27285

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0590w ABC transporter, (CT family), putative
MTTYKENVGISNKGNKKKKSCQNISFLNFLSFDWIRPLINDLIKGDIQELPNICRNFDVPYYASKLEENLRDIEVEDSEF
YSEKNSSNEHVLHHCNSNDASEKKVYNVYYHNILWSILKTFKFRIILIISFYILETLIVTLGGKFIDYYMRILEGQKIPV
YISFLKDFKVFSGLVVVMIMFFHLFFEALLHFYFHLFTINLKVSLMYFLYKINLCSNNNHLQNPDAFYNTYRKFSSQTEI
DEISRDFLSIGKNASSSSSGIKNNNKNIDNNKFVENDYIINFIKSTKKMEKDSLNENRSLPNVNIYNIMFSDVPSVTFFV
TSCINLFNVFVKIFMSFYVFHIKIGSNSVGIAIWLSIALYSAMILFEFLPSLFKSKYLIYRDKRIDNMHHVLKEFKLIKM
FNWESFAFKYINIFRMKEMKYCKIRLYLSNIGVFISSISSDIVEVVIFFIYLKDRLNKKEEIKFTSIIMPLYVYKILISN
VANFPNLVNNVMEGIVNIKRLNNYINDHLYYNDIKNYFMYRTRYNEDYNIVVDKTFLQNENITSHDDGTSHNLKHLKNVI
KNKLTNMFKYFFFYHKMNYHKNIINKQILSGLLKNVDDNTNKKICFQEHKSNSTYNYNSSHIHEKKEEYENIHNSSNSTM
SNEFKEKKKNNEYIIKLENCSFGLSYDNKCDNDHILKNINFNLKRNSLAIIIGNVGSGKSAFFHSILGDFNMTHGNLYIE
NFFKKMPILYVPQNSWLFMGNIRSMILFGNEYNPLIYKYTILQSELLNDLSTIEHGDMKYINDDHNLSKGQKVRICLARA
LYEHYIHMHKLCTDYEKKLIQPNEILDKDLINNKNISSYNNKKSKLVNYNIPFNENYLQKCLMDDNNFYLYLLDDIFTSL
DPSISKKIFSNLFCKEDNISFKDNCSFIISMNKSTLDNFLIEDILDNVQYEVNIFEIQDKTLKYRGNISEYMEKNNLNIT
KESHWGYSNLNTIDYTRIKLFDEVELNHVKHSNKMIYKEAYFVKGNTESVSFEIDSINKEYIKKMKKKNYKKEHMNKNNK
DNNNNNNNSNKDDHININMNDNHRNYNDINLGPNSTDDSPTVSSLGNEYTLDTYTSNNSDKEEIVKPLYKDTHEEFNKSS
SMPFVKSSSNMINNPSNFKYEDNSSSFKGSISLETYLWYFQQVGFVLLTSVVIFMLISIFTDEIKFVFLTMMSIISKNNK
EHSDTILQKQVRYLEYFVILPIISLVTSGICFSMIIYGNITSAIKVHNNILYSILNAPLYIFYNNNLGNIINRFIIDISA
FDYGFLKRIYKAFFIFFRCILSSLLIIYMIRDCIFIFPFVIILIYFFVFKRFSRGCKEAQRLYLSCHTPLCNIYSNALSG
KNIINIYKKNTYHLDVYEHYINNFRISYFFKWLINIWASLYIKIFILLLTTYIIMHPHLYASGIIKLYKEKNYVRILSTL
GYCISFSARLGVIIKFLLCDYTHIEKEMCCVQRLEEFAKISNKENASMNKENELNVITTQTYKEKNENISDKISAIVEYK
NVSLSSIINSSQDDESKKKYGIKFENVYVSYKKKIPLVNGTYKYIDEEPSLKNINMYALKNQKIGIVGKSGAGKSTILLS
ILGLINISQGKITVEGRDIRTYNRKGEDSIIGILAQSSFVFYNWNIRTFIDPYNNFTDDEIVHALKLNGINLGKNDLYKY
MHKQDMKSNYKKIIQTSKVINQSNDNTILLTNDCIRYLSLVRLYLNRHKYKIILIDEIPIFNLNNSVHDELNSFLIGKAK
SFNYIIRNHFPNNTVLIISHHANTLSCCDYIYVLRKGEITYRCSYEDVKTQSELSHLLEMDD

Gene-Specific Links for PFA0590w

General Sub-Cellular Localisation Links