ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0445w (CCp5)

LCCL domain-containing protein, a gene from Plasmodium falciparum

Compiled localisation
cell poles during mature gametocyte
during not emerged male gametocyte and schizont
parasite plasma membrane during female gametocyte

Who localised this protein by microscopy?

Scholz, S. M., Simon, N., Lavazec, C., Dude, M. A., Templeton, T. J., Pradel, G.
PfCCp proteins of Plasmodium falciparum: gametocyte-specific expression and role in complement-mediated inhibition of exflagellation. (2008 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

cell poles during mature gametocyte, during schizont and not emerged male gametocyte, parasite plasma membrane during female gametocyte
  • "PfCCp5 and PfFNPA proteins are predominantly localized at the poles of the gametocytes For PfCCp5, in some cases we found a minor labelling of a subpopulation of mature schizonts (Supplementary Fig. S1). After gametocyte emergence PfCCp1 through PfCCp3, PfCCp5 and PfFNPA revealed a patchy expression pattern on the plasma membrane of macrogametes, while PfCCp4 is still associated homogenously with this membrane (Fig. 2a). PfCCp protein expression decreased in Pfs25-positive zygotes or unfertilized macrogametes by 24 h after emergence (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Taken directly from publication, annotation doesn't match
  • Localisation record: poles during mature gametocyte, sometimes during schizont, patchy plasma membrane during macrogamete, not during emerged microgamete
  • Other genes localised in this publication: LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL-like protein, 25 kDa ookinete surface antigen precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18011

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0445w LCCL domain-containing protein
MLKITCVGLFFYIIKSLFVNTKAPETSLEKITEFRQQHRKTLDGRLCAAAFLHDDQTYTNCTTSLSPDGTSGREWCYVEV
QLLGKGSRDWDYCRDSINYDKLRLHAKKVFEEKSLEADRLKDRLHVLNSRVYSMLQKYDSVCGKKHELINSRIEKINEWL
DKSSESIMKIENNTNDLNSTKSIIDQLQIDIKEENKNVKQSEENCKNLPGYENEPHSDGLKVSYFNNLFFDGIPIETRIE
KDINFLYNSRGPLENISPHKYSIRYEGYIFVPHNGTYTFTIETDCYIRLLVNNKVILTYGLEEVVDMTDENMYHYNQHDM
YQYNDGYKLNTPFSFSYPQYSHIKYTLNNDDLSEIIKKNSIPIELLGGEKHKFVLEISHSAHLKYKNEESSSFKLYWKSS
RIHQQIIQSHYFFTENIIPPTRFSSLDPDIFELGLVDINQQVYKNNNNWIITNVNTKYVGLHLLKTQEHPTYNNFSLSIN
TASNLFIASPIDNVFPLSPYKDSLWKVFDTGDIIEIENKGNSNNNNNIIYKKKQFKIKFIPLKNKSELKFYISNNIPFFI
FAQQRKIFPTICNGEQQILSSPSNAVFKECEESSSLSKEFNCIAGLSSLHMDKKFHVWRSLNSGIGEYIKVSFNTPVQIN
KFRFKPRDDVLTWPSEISLLFDDTEIIIPILHTSNIEHNTTKLEHPIITTFVKIEIKDMFLNHNETGGSFELIGNSCNLT
NDDYLTHHGATIDINDCHNNTLNNIPDVLPLIHGDKFLITCDPNCLDNLSGEVYGSDVYSIDSSICKASIHAGVCNIQNK
HNCKFLIIINEKQKNYIGTLQNRILSLNQSNNSNLSFTFSPIINPNFSQFYSSYPNSYSIVFKRNDDLNLPNKFLIDYGD
VFNNYGSFAYGWNKPITFLNSSSQKKKSYSNGLYSGGIPFPPATASQHCITDLECQTNFWTFQTHENGTYTIQVLVGNLS
SDIKQNTFIEVNGLPLIKNIQLEKNEYFVAVKNVHVTSRSLIFTSTCLETDNECANAKTTIMALQILKI

Gene-Specific Links for PFA0445w

General Sub-Cellular Localisation Links