ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0410w (ARP)

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during gametocyte
erythrocyte cytoplasm and erythrocyte plasma membrane during ring and schizont and trophozoite

Who localised this protein by microscopy?

Zhang, K., Fujioka, H., Lobo, C. A., Kitayaporn, D., Aikawa, M., Kumar, N.
Cloning and characterization of a new asparagine-rich protein in Plasmodium falciparum. (1999 Dec, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during gametocyte, erythrocyte cytoplasm and erythrocyte plasma membrane during ring and schizont and trophozoite
  • "In all the stages, the fluorescence was localized on the surface as well as in the cytoplasm of infected erythrocytes with a punctate distribution pattern (Fig. 4A, insets). A similar, however less intense pattern was obtained with gametocyte stages (not shown)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein against epitopes 1493-2222 and 1493-1723
  • Strain:
  • Gene model mapping comments: Blast from AF047005, annotation doesn't match
  • Localisation record: Weak Surface during gametocyte, Erythrocyte plasma membrane and Erythrocyte cytoplasm punctate during ring and troph and schizont
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29330

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0410w conserved Plasmodium protein, unknown function
MESYIRESKKLTLKSNKGKKLLRYLDISLNNKSLHDSHILELVKILKKIIKIVYNTYYCLNIDLSENYITCIGLKTLLKY
ILNYNENIGVNILKLYKNSIKDDGALLIKQLVYIQKIPMEELHLSHNLIQDNACKELLLSFVQAKKDSTYVYPRYDKYQN
PYKHAQIPVWIRLEYNCIHNPKDILKEVEDCAKKKRGYKSNLIVCSALKSDKRCCPYKCLNASIRNTPIMHVYMFIHQKE
NIVNGKMKEEKNDFVSLEGVLDKNEKSNFNNDKNADENMIKLDSSKLGNKNKFKNENDEFEEEEEEIDVDDVDDVDDVDD
VDDVDDVDDVDDDEDDEDDEDDEDDDEDDDEDDDDDEDEDDDDDEDEDDDEDDDDDEDYDDDDDEDYDEDEDDDDENYNL
KDKNNLKGFENNKRIKGNKKGSEKPFVVNKEMVVENKNKNINNEEDEKNIDKKKSMNKKKRKKKKKRVNNYNNNNNINNN
NNNNSNNKKKSNLVKDKKNSSTSTCNKFMNNTHNLNKSFSNIASDMYNKDTNMSSLNTSENTLPLYIILDCSAVLDMKEL
WKDKSILPFSFPGLLYLYNNKLLKANTIGNNNIHMNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSSSGN
NNTNKPGNDNFICLMCSYVANELKMVCQKSEIIRQKMINLKLNIWDKLSELGIIEFLSVPKDFKENKKNFLNSSFLTDEQ
IKLANEYYDISYETLQMIQFSIVWSTYIFKISNKEIIIENNKKEINKSDMKKSKKTIFTEVLYLTSSSNIYSFFEYLYEQ
DINFILPLCVTVNQINKYIQDEHSYIIDILMNNAKADKYGKLQFNKSFFQQFIKEKYSKYLYTNTKEEIINDKKKQSKST
LCNTKPLSCDILEQVNEEQQMFNSIKNKDGILSSQNNLQNNNGSEYLIDDGMGTMRISDDMLNNSNDIKKKKNNNNKKFS
SVQQMVDNKSVAQPILSHNNNNNNNVNSINNNNNSYDIYDIISVKSFSNDNVNNMCNVDKMMNVHNNIVSSKNMKEDELL
KEHHLYLKKGSEVVPNNQYYNLGEYNKLNLQMLNITDLDILEKRTDINDIFNNSLSETNKSANNTTTNNNNNNNNIHNNI
HNNIHNNIHNNGAVRTNPVSSENHLILDNRNNKKKTDMLENMLYCSTVESKLMGLNKNKMEANLDMNNDNINNDNINNDH
LNNDNINNVARGHTVDSELTTEDPVIQKKGVCKDKSGTPSDNKVSIYELLINAFNGKKKNVTKNVNEKNKNGVNEEGVGL
MNDANCNTNNMNNVDNTNNVDNTDKLDNTDNLDNTNNVDNTNNVDNTNNVDNTNNMNNNNNMNRDDKDQSILMSQIKLKN
DHRIEEEELQLKGKTNHKDNVINEKRKSMVEKKSISLHKNVNNNDNLAFLNNQQDDNVSHANHTRSTIHKMSVFHNNNMS
NIPSGCAMQNDEDNMVLLGNENMLFKKGGSIMNFGDVDNNTTCAMNKNERRLTNNMKSGHNIIADNKDEELLNVEKINNG
ELLHIGKNICSEQLINQRKVVEWKHSFENHKVDIVNTSMLLEELILNPTVCKYVPGELYNRILKCYEKLDFMITNLNNIN
EEMETMKNVYNTEGNNNKNNNNNNNNEHGEHNIDNIVNKNVRTSLLKNDNIKTTTTERNNSINHSMNKNDVSMMYDDFKN
YWDSPLGKNNSINNLMMMNNSINNINSGFNSMNLTASELMKSLSNGIHLNQKMNTLTSSLPHDFLLNNNMLGSMTNNNNN
SNNNNNNNNSNNNNNSNNNNNSNNNNINLGMTTPLNNANIIQNHLNNSMLKNNMVNKNSAHNLASHLNNNNKVSKKKSTL
STYNNNMNEGNNSMNLNMNMNSTNNLNSSSVMMMLMNSAQNNSIQKKYINNNNNNNYNNNSNSNNNSSNSNNNNDMTVLL
NNMNDVRINPNVLLNNNNLFFQGNNYKKDESNTGNKMSKDMNVINNAHANVEIMKNDNMSNNNSSNNNFVVGRDLKDIKT
LNKILLLNNSNLNSVKGVSLNEKQLLNYINNNNNNSSSSSNNNMSGIPSVNSNIDTNLLTLLNMTKNNNNNNNNNNNNNN
YINNIGSGINSTGISNKNLMINHQNAKNNNHNNNNNDKFKGNPFNDFNGIVTSNNIKKILNNENNNNNNLYMMNNNKTPI
NDINVKYVEALNSQFNFLSRDSRKIDTENNAINILNFSNDLEKKSNNTMVDICEKTNDKKI

Gene-Specific Links for PFA0410w

General Sub-Cellular Localisation Links