ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0345w-b (CEN1)

centrin-1, a gene from Plasmodium falciparum

Compiled localisation
during gametocyte and oocyst and schizont

Who localised this protein by microscopy?

Mahajan, B., Selvapandiyan, A., Gerald, N. J., Majam, V., Zheng, H., Wickramarachchi, T., Tiwari, J., Fujioka, H., Moch, J. K., Kumar, N., Aravind, L., Nakhasi, H. L., Kumar, S.
Centrins, cell cycle regulation proteins in human malaria parasite Plasmodium falciparum. (2008 Nov 14, J Biol Chem) PubMed / full text
   more detail about this publication

during gametocyte and oocyst and schizont
  • "Asexual blood stage schizonts (A); gametocyte stage (B); and oocyst stage (C) P. falciparum parasites were probed against mouse anti-PfCEN1, -2, -3, and -4 antibodies."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: MAL1P1.61 taken directly from paper, and this redirects to PFA0345, annotation matches
  • Localisation record: during schizont and gametocyte and oocyst
  • Other genes localised in this publication: centrin-2, centrin-3, centrin-4, heat shock protein 70, alpha tubulin 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12346

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFA0345w-b centrin-1
MSRKNQTMIRNPNPRSKRNELNEEQKLEIKEAFDLFDTNGTGRIDAKELKVAMRALGFEPKKEDIRKIISDVDKDGSGTI
DFNDFLDIMTIKMSERDPKEEILKAFRLFDDDETGKISFKNLKRVAKELGENITDEEIQEMIDEADRDGDGEINEEEFMR
IMKKTNLF

Gene-Specific Links for PFA0345w-b

General Sub-Cellular Localisation Links