ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0330w (AARP2)

small ribosomal subunit assembling AARP2 protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm and not nucleus and parasitophorous vacuole during schizont and trophozoite

Who localised this protein by microscopy?

Barale, J. C., Attal-Bonnefoy, G., Brahimi, K., Pereira da Silva, L., Langsley, G.
Plasmodium falciparum asparagine and aspartate rich protein 2 is an evolutionary conserved protein whose repeats identify a new family of parasite antigens. (1997 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm and parasitophorous vacuole and not nucleus during schizont and trophozoite
  • "Panel A shows trophozoite nuclei labelled by propidium iodide and in panel B, the pattern given by the same parasites with the PfAARP2 specific mouse antibodies. The comparison of panels A and B reveals that PfAARP2 fluorescence is removed from the nucleus, consistent with its presence in the parasitophorous vacuole and probably the cytoplasm of the infected erythrocyte."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: Palo Alto
  • Gene model mapping comments: blast from Y08924, annotation matches
  • Localisation record: not nucleus and parasitophorous vacuole and erythrocyte cytoplasm during trophozoite and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11310

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFA0330w small ribosomal subunit assembling AARP2 protein
MDDKKKHHKKKKVGKKSKKKKINKNGNNKKYHKAFAFSGGIKSAHRRKQHLFELEEKKLRVQKVYKEGNKSSPLIVVIQG
AKGVGKSTLLKSLIKYYVGITINNIKGPISIFTKNLKRYTFIEVNDDILHMIDVAKIADICILVIDGSYGIELETLEFLN
ILYTHGLPKVLGVVTHLDKFKDSKSIRKRKKKLNKRYSEELVEGSKLFFLSGIQNNRYNKTEIRNLCKFLSVIKKPIISW
REQHGYILGLKLDVDDLLINNQITSQKNNLQSEHVHNENYVNHASYDNDNDNDEENEKKLTNFLTNCDEKIKISIEGYVY
GSKIYKNQKVHIPNIGDVEIDNIQILQEPFKLDEQKKNPNIYAPMSDVGNLTFDFDNMYIHIPKNKVNFTREEFLLADQR
EETIPGDHSGEKNGNTLKDDEGGGDGDDDDDDVGDDNVDDGDDDDDDVGDDNVDDDDGNDDDDDDNDDDDNDDDDNDDDD
NDDDDDDDNENSDKSSHHNKQSNDNEKYITDSIKMIRELQKSNGVFSKQQKDNLILFNETNDNNGASNIRRKAPSNVYIS
EKQKKKKQQDSYVNEKAEEYNKLESILYEKKNNDEEYYCANNVTISSDDDKEENDASFREFYRKYGLNADMSDDGGNNDI
NIYNGQESEEKLKDTYDKLIDGGHDEDDYDDDENVGDENDDDEENDDDENDDDEENDDDENDDDEENDDDDDENDDDDEN
DDDDENDDDDENVGDDDENDDDDENVGDENIDDDDDDDYNNYNNKELKHKNTLDPNKSTVNRMEAHDIADILSFDNKISL
DTFIYDFSYINRKNNLLYFRGDVINVIKREERKLDESCHLQEYEEHFYFIKNMLSTDIVEDKKRGCYSFMNEDNYYYDKL
DTFRSDEEDIFIFNNLSISLYDIVDSNIVDNFFSRYDKVYRMFFKNRKRGNMGINSEGDDNNNNNSDDDNNINSDDNNSN
SDDNNSNSDDNNSNSDDNNSNSDDNNINSDDNNINSGDDNNLKDKDKGNIGNEINIKENLKKLKEEKLIEKEKFRETEKI
GVLNSGYGSSVNIGEYVRIELNIEKKKLAILKNNLIICGGIQTYEEKDSLIHCRIKKHRWFPKLLRSNDPLIFSVGWRRY
QSIPIYSISERNNVRLRYLKYTTEHMHCNCTFYGPLASVNSGILALYNYKKVPFYRICINGLIIETNNNLNIMKKLKLIG
EPYKIFKNTAFVKNMFNSDLEVCKFLNCPVVTPSGIKGLIKNKINNNGDFRCTFADKIRMSDIVILKLYVNVKIKKFYYF
DIENKIKSINELRYLYNIYVNHNNNYRSIPFRHFYHTKIQIKSKLLKDLPFKSKPKLFKKLQNHANLNNKQLTNNINNKK
TKTDQINFNALPNPKLAAKWYQMLHTIKKNILDQKKAKSQLSYHKKLKEKLKIQQAKTQVVKQRKKISYKKGRK

Gene-Specific Links for PFA0330w

General Sub-Cellular Localisation Links