ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0280w ()

asparagine-rich antigen Pfa35-2, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFA0280w asparagine-rich antigen Pfa35-2
MKKNPKSIEEITDLPHVDNSDNCMKMNNIKNGDDGNNNYGKSDNTNETNLNDTLSYNKYGNNFLSYNGNYGSNKMYSNQN
INNRYYNKIHFNEENYEYFGRGRNYKNCNNNGNYNNNNNNNYNYYNHYNNNSSSNNNNNNNSSGISNNYHDGDYVKYNKK
GSTIHNRYNNIYTTSTTHNTYNNNNNNNNSSSSSHNFHISNNNLSGNNYHYYNPYNYYNGCTTIDNELNEKDHKQISSKK
MSNSVATARSEYTSESKEYQANDINKKKNEFNRNDTCKNDVKTNDVKTNDVKTNDVKTNDGQTNDVKTNDVKTNDMKTND
MKTNDMKTNDMKTNDIRPMNKDQNMKKNIRINKNYFPKGITSPRNNGNTNDTYIRDDNVLNTYEESFTMKNKKKNYYRYQ
NNYKNNTSNHFYNSLNMKLINYGNFGYNNNNHYNNSYNNSSNNYYHNNNYHNNHRVNIHMNYRNKNNCMNNYYPYNNYID
TKENDTMQKGTSSRNILYDNKNDDTNFNCFGKDKYANKKNEIDKNQNDSVVVYDENTNKEDHKDDNKNSSNDNIPNVNNS
DNCNLTSDDRIKSSIQENNTCISPKNNSVVLNNTNMEENRSYSNNDNASKDIIMDNMCDKYKKEGKPSENSVYVNTYNDK
EKTNHDSDVAMEKDNSDIIYTEIEQNYNKKNNNNDKKKEDNIANVKAHSNFYDTFDNNDKRDDENGMAEIKGEEENLDIK
KISNKNSMNKNNVSYLENEQYLKCKIGEVKNKNEQGNTAEDNNNNNNNYSNNNNNNSNYNSNYNYNYYYHNNINDYDDYY
DINDNNNLFKDENFDNSTNNKSFKYNNRNNIKNDHSFKSHIQCNMNNSYNYSNGNTLHCEGSKELSYEKNHYSFSKNETF
KKKGPNKNYTNGYNFNYSNRSGKNMKNHNYAYNNFNAGYQRSNMSKDNKYNDNEGNNMYENGENNNKGDTIKNNDIIYDK
REDDKNIKHVKYDDDHNQNRDNDEDKDKDHNQDKDRNQDKDRNQDKDRNQDKDHNQDKDRNQDKDRNQDKDHNQDKDHNQ
DKDHNQDKDHNQDQNQDQNQDSIIKNNHIISIEDDKKECEIYYHRDNNIINFDKTDNNCDVQYSPNLQNDDPNITIENKE
EKNINTDITICDGSIIPNNKNYTYNNYRNEEKNRIRNNCQGVINMIHDNDNMNYHPISKKRFGYFKDKNFSYNKHVEADN
NVRNYVDHTSINISTYNDSYKTNFQRKKDYNSYMTMPYSNKKDIKYYKKKGKIERRIKEHNCYSGIIGENERNKIIDNIG
VTTSNGYITHNIQNIQNIQNIQNIQNFKNIPNVKNMQNVQNIPNISKISNMPNISNISNGSNIPNMYNITNIPQIVKGQD
QFCNSTYGRSNKERKAIISSNSTTNLTFDTKKKATQNTWVIDHINNEEEEQMNNITSISNTTVNCYKSEFSCYKDNYKYK
KHSTHISTPNYSMNKDNGVLNVISSVDKLVKNEYMYNEEKGRKRANKINNKMNWQKKGFMLEQNREKINIVLNEEMNMPN
VVNCTNTPTVLNDAKESQTYDELKQKKKNKKKIEELCCMKKSIDMLHVRSRSENFHCRKNSFKNLEISMMKPHMQHFEQS
INMEGFRCILSKMMINYEGDMLVDDQEEEEKEEEKKGQEKGHKCECKCECKCQCQCQCEQYNDNKKHPEHDKEDNIIQKK
DDDEIKTEKDHKEEEQEIYNTKEEPQYYSNNNVHNESYVTHHDSLKNNETISTNTSGCSMIKNDDSFGDSVISNSYVYKE
NDLNTNSCINKLKQLKDDNIKKDNSMKETYMNNMNMNTMDSIHFDSIHIDSLHIDNLHIDNININTTNNIYKNGDITNNN
RNGGDVNRALFNSRENITDDYSMKTQNTFLCIYDENNKEMFDKKKKKKGFYQKNDLSMKKDVGGDIILNKHSLEEKNNCD
LTIYTNNINNTDKNMENCYDTSCATKTYDNINSRKFGIDTYVKESAKITNRLWNNNIDRYSYKNGRNGVYYNEYGKMEGG
TYDYHPSNMMYKKFGKNNDNDNDNNNDNNNDNNNNIDDDNNNENNNNNNDDNNNINNDDNNNNNNDDNNNNNDKSNSMNN
NFGNYHNNNSNSNSHYNNYHHNNNYHHNNNYHHHNNYHHHNNYHHHNNYHHNNYHGNNHFNNYHHNNMNSYNEGRTIPNN
SYSGKNSYNNNMGEHINNIDITAGQRVLKDDMNKNNLYMVHNQHNFEEYKNYMNTNVIRYNNLHKKKYVTGTNYQVSNYN
DTYHFNNMRGKQYYLNKYNYNNHHDMVYTNGKNVDVYKHMRANNKIETYNHMINGMNDINVNNNVRNNTNSYSNDSYLHA
QSGDVQKVYTNDEIVNDKHNNNDNNNDNDNICNSSNNNMVAVDINEENNKNNKSNKSEVINKCDDNNDEHDKMDSKSVVS
YKSYGNKSGISDKYFNKHNNENNYKYSNNNYFNQSNDMNKITNKYMNHNYSNDNFKDNYNNSNDKKKNLHYFKKNKMNNT
FNSNRNKYGIENYDDVNYPKDYNEDKMNNNNNNNKNRDRHNYHTGDRNNYYYHNHKNGYDFGVENIPSQIKRRHRKYMPA
NNYQLNENHSTMNNNNNNNNNNNNNDNNNYNYDYNNNNKKYYYNNNYNNNDYYYYCNDDNYYKQTYEKNNQDYHNDEFNL
PINYYEDNIKENNQMKDNNEFFKTEEKINEENKVEKEDSNEEREKIKNEKFMCDENLIRDEKLTCDEKLTCDEKLTCDEK
LTCDEKLIRDEKLTCDEKLTCDEKLMHDEIEGDRKKIQENVIPSKVDKDIKRRKKKEHFNNSFSKTNIFNNSYNIKNLNN
NDNKNMNTISDDTNTINERNAKNKKKKKNYQNNVDVVLDNIETVPRAREEKLRKQKKDNKKIYKLKDNNIKDNNIKDNNI
KDNNINEDRHYDDNYKDDNYKDENNCDGNNYDNNNNNDNNNYNDNYNENNNNYYYDDDSTIIKKNSYTYKVKDHSYYNYN
RNISSTNKYESNYIVHEHNSYNNNNNNNNNNNENYTNYTNYTNYTNHTNHTNPYEYKKNSYNKNNNYNNKTNNMYDTNTY
NKGYKNYKNKNHKTTPTEQYKKF

Gene-Specific Links for PFA0280w

General Sub-Cellular Localisation Links