ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0125c (EBA-181, JSEBL, EBA181)

erythrocyte binding antigen-181, a gene from Plasmodium falciparum

Compiled localisation
microneme during extracellular merozoite and schizont
not rhoptry during extracellular merozoite and schizont

Who localised this protein by microscopy?

Haase, S., Cabrera, A., Langer, C., Treeck, M., Struck, N., Herrmann, S., Jansen, P. W., Bruchhaus, I., Bachmann, A., Dias, S., Cowman, A. F., Stunnenberg, H. G., Spielmann, T., Gilberger, T. W.
Characterization of a conserved rhoptry-associated leucine zipper-like protein in the malaria parasite Plasmodium falciparum. (2008 Mar, Infect Immun) PubMed / full text
   more detail about this publication

microneme and not rhoptry during extracellular merozoite and schizont
  • "The gene product of the cytoadherence-linked asexual gene 9 (clag9) (64) was used as a second rhoptry-specific marker. CLAG9 was previously localized exclusively to the bulb of the rhoptry (31). The distribution of CLAG9 predominantly overlaps with that of RALP1 (Fig. 5B). In contrast, the apical distribution of RALP1 was clearly distinct from that of the micronemal marker proteins EBA-175 and EBA-181 (19, 53) (Fig. 5C and D). Together, these findings establish RALP1 as a novel rhoptry-resident protein."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not rhoptry during schizont and free merozoite
  • Other genes localised in this publication: rhoptry-associated leucine zipper-like protein 1, cytoadherence linked asexual protein 9, erythrocyte binding antigen-175

Treeck, M., Struck, N. S., Haase, S., Langer, C., Herrmann, S., Healer, J., Cowman, A. F., Gilberger, T. W.
A conserved region in the EBL proteins is implicated in microneme targeting of the malaria parasite Plasmodium falciparum. (2006 Oct 20, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "Truncation of the cytoplasmic domain of both EBA-181 and EBA-140 does not interfere with microneme localization of either protein (Fig. 2, A and B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2mef
  • Gene model mapping comments: annotation matches
  • Localisation record: microneme during schizont and free merozoite
  • Other genes localised in this publication: erythrocyte binding antigen-175, erythrocyte binding antigen-140

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0125c erythrocyte binding antigen-181
MKGKMNMCLFFFYSILYVVLCTYVLGISEEYLKERPQGLNVETNNNNNNNNNNNSNSNDAMSFVNEVIRFIENEKDDKED
KKVKIISRPVENTLHRYPVSSFLNIKKYGRKGEYLNRNSFVQRSYIRGCKGKRSTHTWICENKGNNNICIPDRRVQLCIT
ALQDLKNSGSETTDRKLLRDKVFDSAMYETDLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKLVEESLKR
FFKKDSSVLNPTAWWRRYGTRLWKTMIQPYAHLGCRKPDENEPQINRWILEWGKYNCRLMKEKEKLLTGECSVNRKKSDC
STGCNNECYTYRSLINRQRYEVSILGKKYIKVVRYTIFRRKIVQPDNALDFLKLNCSECKDIDFKPFFEFEYGKYEEKCM
CQSYIDLKIQFKNNDICSFNAQTDTVSSDKRFCLEKKEFKPWKCDKNSFETVHHKGVCVSPRRQGFCLGNLNYLLNDDIY
NVHNSQLLIEIIMASKQEGKLLWKKHGTILDNQNACKYINDSYVDYKDIVIGNDLWNDNNSIKVQNNLNLIFERNFGYKV
GRNKLFKTIKELKNVWWILNRNKVWESMRCGIDEVDQRRKTCERIDELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKC
TGNNGKSLCQDKTCQNVCTNMNYWTYTRKLAYEIQSVKYDKDRKLFSLAKDKNVTTFLKENAKNCSNIDFTKIFDQLDKL
FKERCSCMDTQVLEVKNKEMLSIDSNSEDATDISEKNGEEELYVNHNSVSVASGNKEIEKSKDEKQPEKEAKQTNGTLTV
RTDKDSDRNKGKDTATDTKNSPENLKVQEHGTNGETIKEEPPKLPESSETLQSQEQLEAEAQKQKQEEEPKKKQEEEPKK
KQEEEQKREQEQKQEQEEEEQKQEEEQQIQDQSQSGLDQSSKVGVASEQNEISSGQEQNVKSSSPEVVPQETTSENGSSQ
DTKISSTEPNENSVVDRATDSMNLDPEKVHNENMSDPNTNTEPDASLKDDKKEVDDAKKELQSTVSRIESNEQDVQSTPP
EDTPTVEGKVGDKAEMLTSPHATDNSESESGLNPTDDIKTTDGVVKEQEILGGGESATETSKSNLEKPKDVEPSHEISEP
VLSGTTGKEESELLKSKSIETKGETDPRSNDQEDATDDVVENSRDDNNSLSNSVDNQSNVLNREDPIASETEVVSEPEDS
SRIITTEVPSTTVKPPDEKRSEEVGEKEAKEIKVEPVVPRAIGEPMENSVSVQSPPNVEDVEKETLISENNGLHNDTHRG
NISEKDLIDIHLLRNEAGSTILDDSRRNGEMTEGSESDVGELQEHNFSTQQKDEKDFDQIASDREKEEIQKLLNIGHEED
EDVLKMDRTEDSMSDGVNSHLYYNNLSSEEKMEQYNNRDASKDREEILNRSNTNTCSNEHSLKYCQYMERNKDLLETCSE
DKRLHLCCEISDYCLKFFNPKSIEYFDCTQKEFDDPTYNCFRKQRFTSMHYIAGGGIIALLLFILGSASYRKNLDDEKGF
YDSNLNDSAFEYNNNKYNKLPYMFDQQINVVNSDLYSEGIYDDTTTF

Gene-Specific Links for PFA0125c

General Sub-Cellular Localisation Links