ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFA0110w (RESA)

ring-infected erythrocyte surface antigen, a gene from Plasmodium falciparum

Compiled localisation
dense granule during merozoite and schizont
erythrocyte plasma membrane during early trophozoite and intraerythrocytic and ring
parasitophorous vacuole during early ring and early trophozoite and merozoite and ring
erythrocyte cytosol and intracellular during trophozoite
not merozoite surface
erythrocyte cytoplasm during ring

Who localised this protein by microscopy?

Ito, D., Han, E. T., Takeo, S., Thongkukiatkul, A., Otsuki, H., Torii, M., Tsuboi, T.
Plasmodial ortholog of Toxoplasma gondii rhoptry neck protein 3 is localized to the rhoptry body. (2011 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

dense granule during schizont

Moyano, E. M., Gonzalez, L. M., Cuevas, L., Perez-Pastrana, E., Santa-Maria, Y., Benito, A.
Molecular cloning and characterisation of the RESA gene, a marker of genetic diversity of Plasmodium falciparum. (2010 Jul, Mol Biol Rep) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during intraerythrocytic
  • "The gold particles were distributed over the infected erythrocyte’s surface (Fig. 4), confirming the presence of the RESA protein of P. falciparum (Dd2 clone)"
  • Microscopy type: EM
  • Microscopy method: antibody to C terminal
  • Strain: DD2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: erythrocyte surface during asexual
  • Other genes localised in this publication: -

Yeoh, S., O'Donnell, R. A., Koussis, K., Dluzewski, A. R., Ansell, K. H., Osborne, S. A., Hackett, F., Withers-Martinez, C., Mitchell, G. H., Bannister, L. H., Bryans, J. S., Kettleborough, C. A., Blackman, M. J.
Subcellular discharge of a serine protease mediates release of invasive malaria parasites from host erythrocytes. (2007 Dec 14, Cell) PubMed / full text
   more detail about this publication

dense granule during schizont, erythrocyte plasma membrane during ring
  • "(A) Schizonts of 3D7SUB1HA3 clone C10 dual-labeled with the anti-HA mAb 3F10 (HA; green) plus mAb 61.3 (RhopH2; rhoptries, Ling etal., 2003), mAb 4G2 (PfAMA1; micronemes, Harris etal., 2005), or mAb 28/2 (RESA; dense granules, (Aikawa etal., 1990)."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granules during schizont
  • Other genes localised in this publication: subtilisin-like protease 1, high molecular weight rhoptry protein 2, apical membrane antigen 1, merozoite surface protein 1

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

dense granule

Rug, M., Wickham, M. E., Foley, M., Cowman, A. F., Tilley, L.
Correct promoter control is needed for trafficking of the ring-infected erythrocyte surface antigen to the host cytosol in transfected malaria parasites. (2004 Oct, Infect Immun) PubMed / full text
   more detail about this publication

parasitophorous vacuole during early ring and early trophozoite and merozoite and ring, erythrocyte cytosol and intracellular during trophozoite, erythrocyte plasma membrane during early trophozoite and ring, dense granule during merozoite
  • "Right panels, RESA1-117-GFPRESA. The very early stage parasites show a beaded PV pattern (G) (one bead is marked with white arrowhead). As the parasite matures, the cells show bright fluorescence from within the parasite and a weaker fluorescence signal from the erythrocyte cytosol (H to K). In more mature parasites, occasional extensions or blebs of the PV are observed (I) (white arrow). Schizonts show labeling of the PV surrounding individual merozoites (L)."
  • Microscopy type: Light
  • Microscopy method: GFP tag after 117 amino acids
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, blast from X05181, annotation doesn't match
  • Localisation record: beaded PV during early ring, bright intracellular and weak erythrocyte cytosol during troph, PV during merozoite
  • Comment: Dense granules, Erythrocyte cytoplasm, PV
  • Other genes localised in this publication: -
  • "In ring- to early-trophozoite stage parasites, endogenous RESA is located mainly at the erythrocyte membrane (Fig. 6). Indeed, an analysis of sections from three different cells revealed that 78% of the 10-nm-diameter particles were in the erythrocyte cytosol or closely associated with the erythrocyte membrane. Gold particles were also occasionally observed associated with the PV (Fig. 6A, panel b; Fig. 6B, panel a) (7% of 10-nm-diameter particles) and with structures in the parasite cytosol (Fig. 6A, panel c; Fig. 6B, panel a) (15% of 10-nm-diameter particles). "
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: erythrocyte membrane and sometimes PV during ring and early troph
  • Other genes localised in this publication: -
  • "In schizont stage parasites, the antibody against endogenous RESA revealed a punctate fluorescence pattern that is consistent with labeling of dense granules in individual merozoites (Fig. 5, bottom panels)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during merozoite
  • Other genes localised in this publication: -

Brown, G. V., Culvenor, J. G., Crewther, P. E., Bianco, A. E., Coppel, R. L., Saint, R. B., Stahl, H. D., Kemp, D. J., Anders, R. F.
Localization of the ring-infected erythrocyte surface antigen (RESA) of Plasmodium falciparum in merozoites and ring-infected erythrocytes. (1985 Aug 1, J Exp Med) PubMed / full text
   more detail about this publication

not merozoite surface, erythrocyte cytoplasm during ring
  • "RESA was not detected on the surface of merozoites but was located at the membrane of erythrocytes infected with ring-stage parasites."
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain: FCQ27
  • Gene model mapping comments: Known from another source
  • Localisation record: not merozoite surface, RBC surface during ring
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26874

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL8P1.204 DnaJ protein, putative
  • PF10_0378 RESA-like protein with PHIST and DnaJ domains
  • PF11_0509 ring-infected erythrocyte surface antigen
  • PF11_0512 ring-infected erythrocyte surface antigen 2
  • PFB0085c DnaJ protein, putative
  • PFB0920w DnaJ protein, putative
  • PFL0055c RESA-like protein with PHIST and DnaJ domains
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFA0110w ring-infected erythrocyte surface antigen
MRPFHAYSWIFSQQYMDTKNVKEKNPTIYSFDDEEKRNENKSFLKVLCSKRGVLPIIGILYIILNGNLGYNGSSSSGVQF
TDRCSRNLYGETLPVNPYADSENPIVVSQVFGLPFEKPTFTLESPPDIDHTNILGFNEKFMTDVNRYRYSNNYEAIPHIS
EFNPLIVDKVLFDYNEKVDNLGRSGGDIIKKMQTLWDEIMDINKRKYDSLKEKLQKTYSQYKVQYDMPKEAYESKWTQCI
KLIDQGGENLEERLNSQFKNWYRQKYLNLEEYRRLTVLNQIAWKALSNQIQYSCRKIMNSDISSFKHINELKSLEHRAAK
AAEAEMKKRAQKPKKKKSRRGWLCCGGGDIETVEPQQEEPVQTVQEQQVNEYGDILPSLRASITNSAINYYDTVKDGVYL
DHETSDALYTDEDLLFDLEKQKYMDMLDTSEEESVKENEEEHTVDDEHVEEHTADDEHVEEPTVADDEHVEEPTVADEHV
EEPTVAEEHVEEPTVAEEHVEEPASDVQQTSEAAPTIEIPDTLYYDILGVGVNADMNEITERYFKLAENYYPYQRSGSTV
FHNFRKVNEAYQVLGDIDKKRWYNKYGYDGIKQVNFMNPSIFYLLSSLEKFKDFTGTPQIVTLLRFFFEKRLSMNDLENK
SEHLLKFMEQYQKEREAHVSEYLLNILQPCIAGDSKWNVPIITKLEGLKGSRFDIPILESLRWIFKHVAKTHLKKSSKSA
KKLQQRTQANKQELANINNNLMSTLKEYVGSSEQMNSITYNFENINSNVDNGNQSKNISDLSYTDQKEILEKIVSYIVDI
SLYDIENTALNAAEQLLSDNSVDEKTLKKRAQSLKKLSSIMERYAGGKRNDKKAKKYDTQDVVGYIMHGISTINKEMKNQ
NENVPEHVQHNAEANVEHDAEENVEHDAEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENV
EENVEENVEEYDEENVEEVEENVEEYDEENVEEVEENVEENVEENVEENVEEYDEENVEEVEENVEENVEENVEENVEEN
VEEVEENVEENVEENVEENVEENVEENVEEYDEENVEEHNEEYDE

Gene-Specific Links for PFA0110w

General Sub-Cellular Localisation Links