ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0758 ()

Plasmodium exported protein (hyp17), unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm

Who localised this protein by microscopy?

Maier, A. G., Rug, M., O'Neill, M. T., Brown, M., Chakravorty, S., Szestak, T., Chesson, J., Wu, Y., Hughes, K., Coppel, R. L., Newbold, C., Beeson, J. G., Craig, A., Crabb, B. S., Cowman, A. F.
Exported proteins required for virulence and rigidity of Plasmodium falciparum-infected human erythrocytes. (2008 Jul 11, Cell) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm
  • "In contrast, the PF14_0758 protein is distributed throughout the cytoplasm of infected erythrocytes with no major concentration on Maurer's clefts in parental CS2-infected erythrocytes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: CS2
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Erythrocyte Cytoplasm
  • Other genes localised in this publication: Plasmodium exported protein, unknown function, Plasmodium exported protein (PHISTc), unknown function

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84685

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0740 Plasmodium exported protein (hyp17), unknown function
  • PF14_0741 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0758 Plasmodium exported protein (hyp17), unknown function
MSKLKCDKLHRINNNNENIGKMNSSVSIIYSTIRKNIHYMKEGTKLYYSLVKILLITFFICIFTRLNHGQFYEKWKNKPN
IKSICGRRLHRSLYEFQISNNSKSFNNVYGNNQNIQIDNYNNVIDYLDDYSQNDVLNNSKSMITNNEIINTKCNALLRKQ
RVLYEEKGDVVLTSEGASETLGDIRNKLKTRSETTNGNIYESGLYGPMKGKIDNLSNKPTDLRRTNNTDYGTKIRTPHMN
VNDNIKSNIREPEPRTKIVNLKNSGVSKSRVVEYEVVPKIVTTKDEGNRKINRVEYEIRAKYDTTRKNEESTNDTTTNDT
SSNMETKNEPAMKNPNVTNDMTKPKTDTTQQIRLNSKSNNMNGVKSNVTTSKETPLEKPSNTVENKEGKNPFIDNDLSDK
KSNMQDNNKGLKVTTNKTNLKNKLGNNTKQIKQGANPFIENDVSDKKDNLQDSNKGLNVTTNKTNDKTKLEDNTKQIKKG
TNPFMDEDELEELLRLEREEKIKNEKKKNEDDNQNKKSNMQDNNKGLKVTTNKTNLKNKLGNNTKQIKQGANPFIENDVS
DKKDNLQDSNKGLNVTTNKTNDKTKLEDNTKQIKKGTNPFMDEDELEELLRLEREEKIKNEKKKNEDDNQNKKSNPSSQN
KTNSQNKQNSQDKTNKQSKLDTQNGKNEKNEKSIPNKLDSQNGKNEKNEKSIPNKLDSQNGKNEKNEKSIPNKLDSQNGK
NEKNEKSIPNKLDSQNGKNEKNEKSIPNKLDSQNGKNEKNEKSIPNKLDSQNGKNEKNIPNKLDSQNVPNKQNIPNKLDS
QNVKNEKDTPNKLDNENKENTQSNKNLNAKKSDIGTNGKSNIETSQDKQLTTKNNDENKNTVKNSKFKDALLEVTKDIEH
GISSDMLNKNQKGKQLKSESLKKNELENKNTKNMDGNKNEFEKGYDLKTECKRDFNISQESGLDYKDEYDGEFNKEYDSY
SDTGSTTMEYDEYYNETYNSDEYDDNYVGNPMKLFTSDIMNNYGNIKSGLKHNTNKIAKTVLKGIDDEESSNKGKNENKK
KKKKDKIVIDKDDTSDNVSLNSTDPELYYNNDDYYGNGNNYENGSYYDSDTYSNIDDSESGDDNPITVLASEIVDACGNI
KGGALKVKDLITEGGPQLLDLTANVVGTKTKDGLNKVKDIVSKKCGIDVESDIDIETETNPLKWHQVVRNKYRKLHFGWK
LFVNISPPAALAIIGTAVAIIPSGASFCAIPFALMAGILFFQVYRLTKKHYYNRKKTVTKKIL

Gene-Specific Links for PF14_0758

General Sub-Cellular Localisation Links