ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0744 (g14.744)

Plasmodium exported protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole during gametocyte committed early ring and gametocyte ring and gametocyte stage i and gametocyte stage ii
erythrocyte cytoplasm and not parasitophorous vacuole during gametocyte stage iii
during not gametocyte stage iii and not gametocyte stage iv

Who localised this protein by microscopy?

Eksi, S., Haile, Y., Furuya, T., Ma, L., Su, X., Williamson, K. C.
Identification of a subtelomeric gene family expressed during the asexual-sexual stage transition in Plasmodium falciparum. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during gametocyte committed early ring and gametocyte ring and gametocyte stage i and gametocyte stage ii, erythrocyte cytoplasm and not parasitophorous vacuole during gametocyte stage iii, during not gametocyte stage iii and not gametocyte stage iv
  • "Immunofluorescence assays indicated that both proteins were only produced in the subpopulation of ring stage parasites that are committed to gametocytogenesis and both localized to the parasitophorous vacuole (PV)b of the early ring stage parasites. As the nascent gametocyte continues to grow Pfg14.744 is detected in the erythrocyte cytoplasm, while Pfg14.748 remains associated with the parasitophorous vacuole (Fig. 4)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 17714601
  • Localisation record: PV during gametocyte ring, Erythrocyte cytoplasm and not PV during stage III gametocyte
  • Other genes localised in this publication: Plasmodium exported protein (PHISTa), unknown function, sexual stage-specific protein precursor, merozoite surface protein 1
  • "Immunofluorescence assays indicated that both proteins were only produced in the subpopulation of ring stage parasites that are committed to gametocytogenesis and both localized to the parasitophorous vacuole (PV)b of the early ring stage parasites. As the parasites continued to develop Pfg14.748 remained within the parasitophorous vacuole, while Pfg14.744 was detected in the erythrocyte."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV during gametocyte committed early ring and gametocyte stage I and gametocyte stage II, not during gametocyte stage III and gametocyte stage IV
  • Other genes localised in this publication: Plasmodium exported protein (PHISTa), unknown function, sexual stage-specific protein precursor, merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14816

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL13P1.11 Plasmodium exported protein (PHISTa), unknown function
  • MAL13P1.525 Plasmodium exported protein, unknown function, fragment
  • MAL13P1.58 Plasmodium exported protein (PHISTa-like), unknown function
  • MAL13P1.59 Plasmodium exported protein (PHISTa), unknown function
  • MAL7P1.220 Plasmodium exported protein (PHISTa-like), unknown function
  • MAL7P1.224 Plasmodium exported protein (PHISTa-like), unknown function
  • MAL7P1.225-a Plasmodium exported protein (PHISTa-like), unknown function
  • MAL7P1.225-b Plasmodium exported protein (PHISTa-like), unknown function
  • MAL7P1.230 hypothetical protein, pseudogene
  • MAL7P1.350 hypothetical protein, pseudogene
  • MAL8P1.163 Plasmodium exported protein (PHISTa), unknown function
  • MAL8P1.215 Plasmodium exported protein, unknown function, pseudogene
  • PF10_0007 Plasmodium exported protein, unknown function, pseudogene
  • PF10_0015 acyl-CoA binding protein, isoform 1, ACBP1
  • PF10_0017 Plasmodium exported protein (PHISTa), unknown function
  • PF11_0514 Plasmodium exported protein (PHISTa), unknown function
  • PF14_0009 Plasmodium exported protein (PHISTa), unknown function
  • PF14_0745 probable protein, unknown function
  • PF14_0752 Plasmodium exported protein (PHISTa), unknown function
  • PF14_0757 Plasmodium exported protein (PHISTa), unknown function
  • PF14_0763 Plasmodium exported protein (PHISTa), unknown function
  • PF14_0764 Plasmodium exported protein (PHISTa), unknown function
  • PFA0035c hypothetical protein, pseudogene
  • PFA0100c Plasmodium exported protein (PHISTa), unknown function
  • PFA0735w Plasmodium exported protein (PHISTa), unknown function
  • PFB0056c hypothetical protein
  • PFB0951w hypothetical protein, pseudogene
  • PFD0090c Plasmodium exported protein (PHISTa), unknown function
  • PFD1185w Plasmodium exported protein (PHISTa), unknown function
  • PFD1210w Plasmodium exported protein (PHISTa), unknown function
  • PFD1215w Plasmodium exported protein (PHISTa), unknown function
  • PFF0085w Plasmodium exported protein (PHISTa), unknown function, pseudogene
  • PFI0060c hypothetical protein, pseudogene
  • PFL2555w Plasmodium exported protein (PHISTa), unknown function
  • PFL2565w Plasmodium exported protein (PHISTa), unknown function
  • PFL2590w Plasmodium exported protein (PHISTa), unknown function
  • PFL2595w Plasmodium exported protein (PHISTa), unknown function, pseudogene
  • PFL2650w Plasmodium exported protein, unknown function, fragment
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0744 Plasmodium exported protein, unknown function
MSRIDTRNNSYRRQNSKAVNEYLYEIIRARNKQAQRKKYLKIFLCISLCILFFLIGYAFIMYNGSVDGRKSLYPKKCSRK
SRSLSELVLANYPSSNYAFSNYASANYSSSNYPSSKMDDLKRHENNCSSSNKAVDEEGICKDTFGNALDVPKYENDSFHR
DYHKSMFDIKNIKLEEISLPLSKLELSHIISRLNKDVPKEYLMNLWLQAFAVSNDLVDIVNLLNEYIQYYKNQVDKCIEL
TSNGNYSCWKNCNVELAQALLFEHIEYKTKFYKVLITRHM

Gene-Specific Links for PF14_0744

General Sub-Cellular Localisation Links