ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0679 (SulP)

inorganic anion exchanger, inorganic anion antiporter, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during trophozoite

Who localised this protein by microscopy?

Henry, R. I., Martin, R. E., Howitt, S. M., Kirk, K.
Localisation of a candidate anion transporter to the surface of the malaria parasite. (2007 Nov 16, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

parasite plasma membrane during trophozoite
  • "By transfecting the parasite with an epitope-tagged version of PfSulP, and detecting via western blot and indirect immunofluorescent assay microscopy, we show that PfSulP is localised to the surface of the intraerythrocytic parasite, where it is postulated to play a role in the flux of anions across the parasite plasma membrane."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Parasite Plasma Membrane during troph
  • Other genes localised in this publication: nucleoside transporter 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12780

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0679 inorganic anion exchanger, inorganic anion antiporter
MLETNKVEDATVNEYVERPEEFNKLDESVERTKLFHNDVYDNDIKICLPTRIGFSKAFMSMVDGIKWGWGFTNTPKETSK
YYINEILCGCILCLTMLPEMISFCMIAKIPPYLGLQGASFLSLITSIFGGSPAVIHGVTGAFASVCSKYLVENNNVDLLP
DGIERLYICIFICSVMLFFFSYFHMSALIQLIPTPVFIGYCNGLSIIFLRAQLHNLKNPYTHEYIKGHYLLFFIIICTLV
VLIVELWKKIPKVGQKIPSSLIAITVTIFVEFVILRKFLHNNFASFKDVKSFTVGDMFSFTSDKAKPTFLFTNKDLNFSK
VEFNMDLIKQVANMFTVLLVEALMVSEVIKDMGGAECDTNETIFSLFIGNVLASLGSAVGGSSLLGLSVLNYRNGARGKE
SGVVASILIYAILLFGYSLLNYIPLSFLCGIMITVFIHCFKWFSIPIVFFTFCPGYIRNCHPCMSRKISRWDAFIIVLVT
VLCVFVSVPNGVLTGIILSALVYVWQSKSTFKFEIFYDRDTDTKYYEIEGHLFYASKKMFTRLFNYENDSSTVNIVLKGK
STLFDYTAIEALTSVKQQYNVNNKNVTIHGLSHECIKKIAKMNHLCKQIDVDLVKVEAPVVPLLYKPLQTIFQKQRTIRR
KMSFKIKKKKKEKVEENLNDIEQP

Gene-Specific Links for PF14_0679

General Sub-Cellular Localisation Links