ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0622 (K2)

potassium channel protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol and intracellular during schizont

Who localised this protein by microscopy?

Waller, K. L., McBride, S. M., Kim, K., McDonald, T. V.
Characterization of two putative potassium channels in Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

erythrocyte cytosol and intracellular during schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22942

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0622 potassium channel protein
MKSGLFSMNDIFFLVNSIFKYFLILLNGSHLLKLLYSSKENIHIIEGLLCIITGVILKLSLIYIYCTYFMNIYIIKDYRR
KNVLNIFNMNNNYKRNGNVIESDDFEYRKLIKKFFFKKVYYSIKKKHKRIELYMLKIYNSNFNYYFCNIRDMCYTIIWYI
SLYYWRRDTYNMIWGFNKIPTYIYNMLLILLSTSYIDLVMVIISYNKSKYYLMKSKLLIDIFFSAPCTYLFSKFIFVFEH
QIDIYFMMGFLRNIKIFLNVSYVRIEHNSILTNTEIKIIRIVLGVLLLCNAFASTIYTIQAIHPYNLDNENFNYFLNSYL
DYFYFSIISISTVGYGDIFPINKLSKVVCIIFIFWTFIWVPIQFNDLIISIFSKKKTYGKISMNNQKFILLIGDVEPQQL
NVFLFESVAQGNKLKFHLLTTYPINIYDEQIKIADHFCISLYIKNFDLNEKENINLLYSINAQNAYYLFLFSNKFHNGHY
NIDTKSFTRLLILKKFLHGKKNAVIELRSNCVSNIVRSIGCENFIIVNLKHSLIVKNIKYPGFITLILNLFTAYNYDISS
YNFNDIASYPSLKYIGEFNRGSRTKIFSFIVHKNMVGLIFDKLFYKLYESLGIILVGIETNTTNYYINNKKHKNKNSYVD
DNFTTMRKNNMKNKKKKSFKFIYLHLLKKYGHTNHYTQKKKKKKYDNIINHHGSKSKMEYSTQLRHNNKTIKIYDEYNTI
ETYQNYLNYETINNSRINIYNSDEKKKKYNDVSPTNNILTNYKNGKLHIEKRDDFDNNNNNNNNNIVKSRKKGRENKNDE
IINVCININSDIKKKYNNNNNNNNNNDNDNNNIINDHDNYNIYNNLNSNLKCRCLPNTKKNKAQNVNNVTNNKDNDVSVK
RIKTHLQDDNTIDNKKELKCYLNLLGKNYAIRDSDKCVVIANSRKVIKYLSKAKSLFWIFEIKSKKKDNISYDLKSVIKT
KQTFNKYFTTNIKKKLPTTSIQNNVYVNKNAHIIAMNYHDLFNTYRISRIFTKNNYNYKRKNSRKKHLFRNLNGEFNETK
LYHHCNNTHNIKTTDKKNMEKLDKLYFSTKLNSKSNTNIHIHNNNNNNNNNNEHYDDEIKTYYFNLTEKNSHLLLNYKKQ
LKKKNYINTCYSVNKSDESINKIKNMNSDNNNINSNNINSNINNNNNNNTKLNHTLKNRITFSYMEACEKYFPTENRNNK
LLLIINCTCNIIQLIKMFNNKYKYNVIILTDEIPTMNIMDLFKYNVVFIKCKILDDYNLINSGLMNAEYILILPTEAKNI
NEINEIDMNTIIVTRKITHLLKKKKRTYYINNIITELINPSNVIFLEENKMIKLKDKKSSYDDFFPYVNSSQFYSSNIIC
ETMLYNFMTHHKSFTDFSVCTNTLECLIKFLRIIYICDLSKYYDFSFKKIKTFRDLFYFLSKKNIITIGLYRKGDKKVPF
YIYTKPNENCLLRFDDIVYIL

Gene-Specific Links for PF14_0622

General Sub-Cellular Localisation Links