ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0598 (pfGAPDH)

glyceraldehyde-3-phosphate dehydrogenase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during hepatocyte stage day 2 and hepatocyte stage day 4 and ring and trophozoite
peripheral during schizont
apical during merozoite
periphery during hepatocyte stage day 7

Who localised this protein by microscopy?

Daubenberger, C. A., Tisdale, E. J., Curcic, M., Diaz, D., Silvie, O., Mazier, D., Eling, W., Bohrmann, B., Matile, H., Pluschke, G.
The N'-terminal domain of glyceraldehyde-3-phosphate dehydrogenase of the apicomplexan Plasmodium falciparum mediates GTPase Rab2-dependent recruitment to membranes. (2003 Aug, Biol Chem) PubMed / full text
   more detail about this publication

cytosol during hepatocyte stage day 2 and hepatocyte stage day 4 and ring and trophozoite, peripheral during schizont, apical during merozoite, periphery during hepatocyte stage day 7
  • "During schizogony, pfGAPDH became associated with the periphery of the parasites and eventually accumulated in the apical region of merozoites, while pfAldolase showed no segregation."
  • Microscopy type: fixed Light
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: blast from primers ATCGCCCATATGGCAGTAACAAAACTTGGAATTAATGG and GCCGTACACATTACTAACAACTAACTCGAGTAAACATG, annotation matches
  • Localisation record: cytosol during ring and trophozoite, peripheral during schizont, apical during merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: fructose-bisphosphate aldolase, rhoptry-associated protein 1
  • "In non-mature liver schizonts (days 2 and 4), both glycolytic enzymes were co-localized in the cytosol (Figure 4, rows 1 and 2). In contrast, in maturing schizonts (day 7), pfGAPDH seemed to be localized at a higher concentration in the periphery of the schizont while pfAldolase remained evenly distributed (Figure 4, row 3)."
  • Microscopy type: fixed Light
  • Microscopy method: monoclonal antibody
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during liver stage day 2 and liver stage day 4, periphery during liver stage day 7
  • Other genes localised in this publication: fructose-bisphosphate aldolase, rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10093

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132640 glyceraldehyde-3-phosphate dehydrogenase, putative
  • PY03280 glyceraldehyde-3-phosphate dehydrogenase
  • PCHAS_132970 glyceraldehyde-3-phosphate dehydrogenase, putative
  • PKH_124290 glyceraldehyde-3-phosphate dehydrogenase, putative
  • NCLIV_037190 glyceraldehyde-3-phosphate dehydrogenase, putative
  • NCLIV_041940 Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12), related
  • cgd6_3790 glyceraldehyde 3-phosphate dehydrogenase
  • Chro.60434 glyceraldehyde-3-phosphate dehydrogenase
  • CMU_017050 glyceraldehyde-3-phosphate dehydrogenase, type I family protein
  • TP02_0858 glyceraldehyde-3-phosphate dehydrogenase, putative
  • TA08145 glyceraldehyde-3-phosphate dehydrogenase, putative
  • TA15530 glyceraldehyde 3-phosphate dehydrogenase, putative
  • BBOV_II002540 glyceraldehyde-3-phosphate dehydrogenase protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0598 glyceraldehyde-3-phosphate dehydrogenase
MAVTKLGINGFGRIGRLVFRAAFGRKDIEVVAINDPFMDLNHLCYLLKYDSVHGQFPCEVTHADGFLLIGEKKVSVFAEK
DPSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKVIMSAPPKDDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAP
LAKVINDRFGIVEGLMTTVHASTANQLVVDGPSKGGKDWRAGRCALSNIIPASTGAAKAVGKVLPELNGKLTGVAFRVPI
GTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTEDEVVSQDFVHDNRSSIFDMKAGLALNDNFFKLVSWYDNE
WGYSNRVLDLAVHITNN

Gene-Specific Links for PF14_0598

General Sub-Cellular Localisation Links