ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0574 (FCP)

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
food vacuole during intraerythrocytic and late trophozoite and ring
food vacuole lumen during late trophozoite

Who localised this protein by microscopy?

Vaid, A., Ranjan, R., Smythe, W. A., Hoppe, H. C., Sharma, P.
PfPI3K, a phosphatidylinositol-3 kinase from Plasmodium falciparum, is exported to the host erythrocyte and is involved in hemoglobin trafficking. (2010 Mar 25, Blood) PubMed / full text
   more detail about this publication

food vacuole during late trophozoite
  • "FCP (red) is located inside the food vacuole of mature trophozoites."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: food vacuole during mature trophozoite
  • Other genes localised in this publication: phosphatidylinositol 3-kinase

McIntosh, M. T., Vaid, A., Hosgood, H. D., Vijay, J., Bhattacharya, A., Sahani, M. H., Baevova, P., Joiner, K. A., Sharma, P.
Traffic to the malaria parasite food vacuole: a novel pathway involving a phosphatidylinositol 3-phosphate-binding protein. (2007 Apr 13, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole during intraerythrocytic and ring, food vacuole lumen during late trophozoite
  • "immunofluorescence using anti-FCP revealed a discrete localization to the parasite FV"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: FV during ring
  • Other genes localised in this publication: histidine-rich protein II
  • "As shown in Figs. 6, Aand B, immunogold particles specifically stained the more electron lucent lumen of the FV. Fig. 6A shows a close-up of a cross-section through a folded FV with immunogold staining for FCP most abundant in the electron lucent lumen and to a lesser extent in association with hemozoin"
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: FCR3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV lumen during late troph
  • Other genes localised in this publication: histidine-rich protein II
  • "stage synchronous P. falciparum was transfected with either GFP-wild type FCP (WT-FCP) yielding a discrete localization to the FV characterized by the presence of hemozoin crystals (arrow)."
  • Microscopy type: Light
  • Microscopy method: N terminal GFP tag
  • Strain: FCR3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during asexual
  • Other genes localised in this publication: histidine-rich protein II

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21072

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0574 conserved Plasmodium protein, unknown function
MLNSKEKEVNGSPSDSLNGDAENENENERKCLWVPDEEVTNCYSCNVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYS
YSEKVRVCDRCFMERSSPQTLLLQEDLGARKQINQDLKKALSEKMAIVERFKTFLIEFDNEILNNTDNTDGNTDVLSLLK
RGEKGLKSLNEKIKNYDSIIEEQKNQLENLKMEKEQKMELNKMLNLRNHEIQQKNINIKNLMKEKNELALVKEESEGIIE
SYKKQVEKLIIRCNQLELEKKTYNKNDLNNFSMTNTSSSSYNQGSSFNLPSNGMSVSYTIADGPNEYMEDENCCNRCQRR
MCNIM

Gene-Specific Links for PF14_0574

General Sub-Cellular Localisation Links