ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0548 (Vps4)

ATPase Vps4, putative, a gene from Plasmodium falciparum

Compiled localisation
cytosol during trophozoite

Who localised this protein by microscopy?

Yang, M., Coppens, I., Wormsley, S., Baevova, P., Hoppe, H. C., Joiner, K. A.
The Plasmodium falciparum Vps4 homolog mediates multivesicular body formation. (2004 Aug 1, J Cell Sci) PubMed / full text
   more detail about this publication

cytosol during trophozoite
  • "PfVps4 localizes to the cytosol of P. falciparum trophozoites "
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from AAN37161
  • Localisation record: Cytosol during troph
  • Other genes localised in this publication: -
  • "Confirming the results by immunocryoelectron microscopy, GFP-PfVps4-WT gave a cytosolic localization pattern by immunofluorescence (Fig. 2B). "
  • Microscopy type: Light
  • Microscopy method: N terminal GFP
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol
  • Comment: stage information not found in publication
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10933

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0548 ATPase Vps4, putative
MDSEETINLAVKYAKEAVVEDEKKNYKEALNLYIQSLQYFNFFCKYEKNSNIRDLILKKMEVYMTRAENLKEMLNKKDSI
ENKEKITNTEETKENMKKQIKQFILNKNNNIKWSDVCGLETAKEVLKEAIIFPLKFPKLFNSSTLPYKGILLYGPPGTGK
TFLALACSNECNMNFFNVSSSDLVSKYQGESEKYIKCLFETAKEHSPAIIFIDEIDSLCGSRTDGENESTRRIKTEFLIN
MSGLTNYKNNIIVMGATNTPWSLDSGFRRRFEKRIYIPLPNIYARAKIFEKYINQNENNNISKEDIKQFATLTENYTGAD
IDILCRDAVYMPVKKCLLSKFFKQVKKNNKICYTPCSPGDSDPTKVEKNVMSLSENELSLPPLTVQDFKTAISNAKPSLS
VDDIKKYEEWTHQYGMNGT

Gene-Specific Links for PF14_0548

General Sub-Cellular Localisation Links