ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0545 (Trx-1)

thioredoxin, putative, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during after trophozoite

Who localised this protein by microscopy?

Yano, K., Komaki-Yasuda, K., Kobayashi, T., Takemae, H., Kita, K., Kano, S., Kawazu, S.
Expression of mRNAs and proteins for peroxiredoxins in Plasmodium falciparum erythrocytic stage. (2005 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

cytoplasm during after trophozoite
  • "Significant expression of PfTrx-1 was observed after the trophozoite stage, but expression was weak during the ring stage"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3
  • Gene model mapping comments: Taken directly from 15387810, annotation matches
  • Localisation record: cytoplasm during after trophozoite
  • Other genes localised in this publication: thioredoxin peroxidase 1, 1-cys peroxiredoxin, thioredoxin peroxidase 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10080

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0545 thioredoxin, putative
MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKN
GSSVDTLLGANDSALKQLIEKYAA

Gene-Specific Links for PF14_0545

General Sub-Cellular Localisation Links