ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0541 (VP1, V-type H(+)-translocating pyrophosphatase)

V-type H( )-translocating pyrophosphatase, putative, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during intraerythrocytic and trophozoite
intracellular inclusion and not food vacuole during trophozoite
intracellular during intraerythrocytic

Who localised this protein by microscopy?

McIntosh, M. T., Drozdowicz, Y. M., Laroiya, K., Rea, P. A., Vaidya, A. B.
Two classes of plant-like vacuolar-type H(+)-pyrophosphatases in malaria parasites. (2001 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

intracellular inclusion and parasite plasma membrane and not food vacuole during trophozoite
  • "Immunofluorescence microscopy of infected erythrocytes revealed PfVP antigen associated with both the parasite plasma membrane and punctate intracellular inclusions."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF115766 and AF115766, inconsistent 5' and 3' UTR
  • Localisation record: Parasite Plasma Membrane and punctate intracellular inclusions and not FV during troph
  • Comment: an antibody was also raised, but that was specific to PfVP1 and PfVP2 at the same time
  • Other genes localised in this publication: V-type K -independent H -translocating inorganic pyrophosphatase

Luo, S., Marchesini, N., Moreno, S. N., Docampo, R.
A plant-like vacuolar H(+)-pyrophosphatase in Plasmodium falciparum. (1999 Oct 29, FEBS Lett) PubMed / full text
   more detail about this publication

intracellular and parasite plasma membrane during intraerythrocytic
  • "Immunofluorescence microscopy using these antibodies showed a general fluorescence over the whole parasites and intracellular bright spots suggesting a vesicular and plasma membrane localization"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody against homologue
  • Strain: HB3
  • Gene model mapping comments: Blast from AF115766, annotation matches
  • Localisation record: diffuse and intracellular bright spots and plasma membrane during asexual
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12221

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132050 V-type H( )-translocating pyrophosphatase, putative
  • PBANKA_144980 inorganic pyrophosphatase, putative
  • PY00513 vacuolar-type H+ pumping pyrophosphatase-related
  • PY06858 V-type H(+)-translocating pyrophosphatase
  • PVX_100710 vacuolar-type H+ pumping pyrophosphatase, putative
  • PVX_117625 V-type H(+)-translocating pyrophosphatase, putative
  • PCHAS_132380 V-type H( )-translocating pyrophosphatase, putative
  • PCHAS_145210 inorganic pyrophosphatase, putative
  • PKH_124930 V-type H( )-translocating pyrophosphatase, putative
  • PKH_145370 vacuolar-type H -translocating inorganic pyrophosphatase, putative
  • NCLIV_064810 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0541 V-type H( )-translocating pyrophosphatase, putative
MDLFYVFLFLPPTIGLIFSIIECIWVSNINIKGPEDKVEKLEDGDNPVEKMKEIASYIAVGANAFLKKEFQYLAVFIIVF
SILLGFFVNSFTAVSFVLGCLTSILCGYIGMKIAVYANVRTTNETWKSLDKGFQVTLNAGTVMGFSLVSFGIIALGLLIF
VYKTYVFKNTIPDNQIYKIIAGFGLGGSSIALFSRVGGGIYTKAADVGADLSGKNEYGIPEDDIRNPACIADNVGDNVGD
MAGMGADLFGSLAESLCAALVIGSSVISIGEGSPGNAFHCILFPLLFVSFSVICSMITFYIITYSVKINDKKDVEKSLKY
LLLLSTVLQSLAILAIGYVCFPSLVKYNYLKDIHRWKIIVPALVGLWSGLIIGFTTEFYTSYSFSPVQEIAHTQKVSAAT
GIIYGLSLGYKSTFIPIICLSATLGISYGLCDIYGIALAAVGMLSTLCICLTIDAYGPISDNAGGIAEMAGLPSEVRERT
DILDAAGNTTAAIGKGFAIGSAALVAFALFGAYASSANLRHVNILNSWVIIGLLIGAMLPYLFSALTMKSVAIAANSVLN
ECLEQFPLILEGKQKPDYEKCIKISTDASLRQMIVPGLISVFSPLIIGMLMGKYATAGLLIGIILSGIQLAFSSTNSGGA
WDNAKKYIESGALGKEHCKGSNAHKNSVIGDTVGDPLKDTSGPSLNILIKLSAITSLVFANVIATKFTSTRGGPIWL

Gene-Specific Links for PF14_0541

General Sub-Cellular Localisation Links