ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0534 (SHMTm)

serine hydroxymethyltransferase, putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during ring and schizont and trophozoite
residual body during very late post-mitotic schizont

Who localised this protein by microscopy?

Read, M., Muller, I. B., Mitchell, S. L., Sims, P. F., Hyde, J. E.
Dynamic subcellular localization of isoforms of the folate pathway enzyme serine hydroxymethyltransferase (SHMT) through the erythrocytic cycle of Plasmodium falciparum. (2010, Malar J) PubMed / full text
   more detail about this publication

mitochondrion during ring and schizont and trophozoite, residual body during very late post-mitotic schizont
  • "PfSHMTm showed a distinctly more pronounced mitochondrial location through most of the erythrocytic cycle and GFP-tagging of its N-terminal region confirmed the predicted presence of a mitochondrial signal sequence. οΎ… In very late post-mitotic schizonts, both PfSHMTc and PfSHMTm were concentrated in the central region of the parasite that becomes the residual body on erythrocyte lysis and merozoite release. "
  • Microscopy type: Fixed Light, live Light
  • Microscopy method: polyclonal antibody to whole protein, GFP tag after N terminal region
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: mitochondrion during ring and trophozoite and schizont, residual body during very late post-mitotic schizonts
  • Other genes localised in this publication: serine hydroxymethyltransferase, acyl carrier protein, chorismate synthase, protein kinase 5

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48162

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_131980 serine hydroxymethyltransferase, putative
  • PY00669 serine hydroxymethyltransferase, mitochondrial precursor
  • PVX_117660 serine hydroxymethyltransferase, putative
  • PCHAS_132310 serine hydroxymethyltransferase, putative
  • PKH_125000 serine hydroxymethyltransferase putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0534 serine hydroxymethyltransferase, putative
MLKEFVKNVNVRNHRYISFYSLRNQSRLNDIDDETYNMLKSYKNKNDINLSLVHNIMPTYMKEYLSIDLNRNIFVNNKNI
ENLEYIALNSFNLQKKYWGCLISNVSLNNNKSIDDYFFIKLYGHFLKKECKILRINYCLEQNIENNVSNDIMQNLYNIIN
IKNRNEPNYDEIQKISNDFNPDIIYFDESNNPYNIDYDRFIKGLKNKNNKIHNKPIIITNMNNKANLISQNLINSPFTHS
DIVFTYFNENFRAHNSFVIFYKKGYKCVNTDGHIIEYDYEKKLKYAFDDIYLNNIFFSFFTSFKLMKNEEFKEYVKQIKE
NTYILYKYINRKYFHIQYSQNNSFFNLNPSSCTFNIQEFYLLCNKLNIYFDILKDKSSNQKSFNIGTNNLTSLGLLTHDI
KNVAEFFNESVVLYFYLKEKSKLTNMSFIQYIEDNSSASDIYSLAVDISSFISSYPSPYTNE

Gene-Specific Links for PF14_0534

General Sub-Cellular Localisation Links