ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0517 (APP)

aminopeptidase P, a gene from Plasmodium falciparum

Compiled localisation
cytosol and food vacuole during trophozoite

Who localised this protein by microscopy?

Olivieri, A., Camarda, G., Bertuccini, L., van de Vegte-Bolmer, M., Luty, A. J., Sauerwein, R., Alano, P.
The Plasmodium falciparum protein Pfg27 is dispensable for gametocyte and gamete production, but contributes to cell integrity during gametocytogenesis. (2009 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol and food vacuole during trophozoite
  • "In indirect immunofluorescence experiments, an anti-PfAPP serum strongly labeled the parasites food vacuole with somewhat weaker labeling of the cytosol (Fig. 1A). A similar vacuolar/cytosolic pattern of anti-PfAPP/immunogold labeling was observed by cryo-electron microscopy (Fig. 1B)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: food vacuole and cytosol during trophozoite
  • Other genes localised in this publication: -

Dalal, S., Klemba, M.
Roles for two aminopeptidases in vacuolar hemoglobin catabolism in Plasmodium falciparum. (2007 Dec 7, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol and food vacuole

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10729

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0517 aminopeptidase P
MVFHLNIFNKGKRQNLVSAYLNHFKKSYFSGVTSGSDCVNKSEVSSDNNNNNNNNNNKIAHNFFSKKYQRNFENNNLSEN
QENNKNIIYSGSNIFKNIYNTEMMSNNNTVDVNMMDNNPAARLEELRTIMKKNKIDVYILINSDEHNSEIINEKDKKIVK
ITNYSGADGILIVTKDKPILYVNALYELQAMNELDQNLFTLRISRIDNRDEIFETISSLEFNTIAFDGKNTSVVFYEKLR
KALLNAYPKKKIVEKIIYNNNFDDVNKKDDENVLNFLVLEKSLVEIKDYPVNNKTLYIHDRKYNGACAGEKIDKLKQSLM
YDIKNVDNLLLSELDEIAYLLNLRGYDYQYSPLFYSYLLFQFDREEQDFSKIVFFTTVKNLPADVKNLLEINKVIVKEYE
EIVPYLRDVVIPSIPKHNDDNPDFKKYDISLSPYINLMIYKLFDRKNVLLQNSPVVKMKAVKNDVEIDNMKQAHILDGLA
LLQFFHWCEQKRKTKELFNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIHYECTDKTNATIKPAIYLLDSGG
QYLHGTTDVTRTTHFGEPTAEEKRIYTLVLKGHLRLRKVIFASYTNSSALDFIARENLFNNFMDYNHGTGHGVGLTLNVH
EGGCSIGPVGGAPLKKNMVLSNEPGYYMKDKFGVRIENMQYVISKEITDTTEYLSFDDLTMYPYEKKLLDFSLLTNQEIK
ELNEYHTTIRNTLLPLVKQSPQEYGESVEKYLIEITEPIAIHNN

Gene-Specific Links for PF14_0517

General Sub-Cellular Localisation Links