ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0443 (CEN2)

centrin-2, a gene from Plasmodium falciparum

Compiled localisation
area near nucleus during schizont and sporozoite
during gametocyte and oocyst and schizont

Who localised this protein by microscopy?

Mahajan, B., Selvapandiyan, A., Gerald, N. J., Majam, V., Zheng, H., Wickramarachchi, T., Tiwari, J., Fujioka, H., Moch, J. K., Kumar, N., Aravind, L., Nakhasi, H. L., Kumar, S.
Centrins, cell cycle regulation proteins in human malaria parasite Plasmodium falciparum. (2008 Nov 14, J Biol Chem) PubMed / full text
   more detail about this publication

area near nucleus during schizont and sporozoite, during gametocyte and oocyst and schizont
  • "In IEM, sections of sporozoites and asexual blood stage schizonts were incubated with anti-PfCEN2 antibody. In P. falciparum sporozoites, IEM localization of PfCEN2 was observed as multiple dots in an area surrounding the nucleus suggesting a possible association with the centrosome (Fig. 5A). Similarly, in blood form schizonts, immunogold particles were seen to be associated with an area in proximity to the nucleus (Fig. 5B)."
  • Microscopy type: EM, Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: area near nucleus during sporozoite and schizont, during schizont and gametocyte and oocyst
  • Comment: centrosome
  • Other genes localised in this publication: centrin-1, centrin-3, centrin-4, heat shock protein 70, alpha tubulin 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21068

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0443 centrin-2
MTDNTAVRRRYEKSFTERPGFTEDEIEEIREAFNLLDTDGTGTIDPKEIKCAMQSLGLDAKNPMIFRMIADLEKDGYSSI
DFEEFMEVITSKLGNKDTREGIQRIFNLFDDDKTGSISLKNLKRVAKELGETLTDEELRDMIDRADSKGEGEISFEDFYT
IMTKKSFL

Gene-Specific Links for PF14_0443

General Sub-Cellular Localisation Links