ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0439 (LAP)

M17 leucyl aminopeptidase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not apicoplast and not endoplasmic reticulum and not food vacuole and not golgi apparatus and not microneme and not mitochondrion and not rhoptry

Who localised this protein by microscopy?

Dalal, S., Klemba, M.
Roles for two aminopeptidases in vacuolar hemoglobin catabolism in Plasmodium falciparum. (2007 Dec 7, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol and not apicoplast and not endoplasmic reticulum and not food vacuole and not golgi apparatus and not microneme and not mitochondrion and not rhoptry
  • "Table 1: Localisation: Cyt"
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: Cytosol, not FV, not rhoptries, not micronemes, not ER, not Golgi, not apicoplast, not mitochondrion
  • Comment: strain information not found
  • Other genes localised in this publication: M1-family alanyl aminopeptidase, aminopeptidase P, M18 aspartyl aminopeptidase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10695

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0439 M17 leucyl aminopeptidase
MYFSSLCKFLPISEKEKIYLNIVKKRFCKSNIYYNNNNNNIINYNKRGLKFYPFCNNLKKNINFVNINNKKGINFHSINK
ERKMASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKNVSEFLKDE
NMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLE
TLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQK
LNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDM
SGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDY
IVDIATLTGAMLYSLGTSYAGVFGNNEELINKILNSSKTSNEPVWWLPIINEYRATLNSKYADINNISSSVKASSIVASL
FLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLNDAL

Gene-Specific Links for PF14_0439

General Sub-Cellular Localisation Links